KEGG   Acetobacter pasteurianus IFO 3283-12: APA12_07350Help
Entry
APA12_07350       CDS       T01814                                 

Definition
dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
apg  Acetobacter pasteurianus IFO 3283-12
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apg00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    APA12_07350
Enzymes [BR:apg01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     APA12_07350
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     APA12_07350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
757992..758537
Genome map
AA seq 181 aa AA seqDB search
MSSLTVYKDTTPEHPVLQTQDPAEMARVLAPLGVRFERWEGPQIPPRDADEQAVLDVYGP
FLDKLMGETGAGSADVLRVSPSTPNREALRDKFLSEHTHSEDEIRFFVHGSGHFILHIAG
YVYDVECTQTDLISVPEGTKHWFDAGPEPDMVTLRIFTHKEGWVARYTGTDIARQFPSYA
N
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagttccctgacagtttacaaagataccacccccgaacaccccgtgctgcaaacgcag
gacccggcagaaatggcccgcgttctggcaccactaggcgtacggtttgaacgttgggaa
ggcccgcaaattcccccaagggatgcagatgagcaggccgtgctggatgtgtatggccca
tttttagacaagctgatgggcgaaacaggtgcaggctctgccgatgtgctgcgggttagc
ccatctacacccaaccgtgaggccttgcgggacaagttcctgtccgaacatacgcatagt
gaagatgaaattcgcttttttgtgcacggtagcgggcacttcatcctgcatattgcaggc
tatgtttacgatgtggaatgcacgcaaaccgatctgatttccgtgccagagggcacaaag
cactggtttgatgccgggccagagccagatatggttacgctgcgcattttcacacacaag
gaaggctgggtggcccgctatacaggcaccgatattgcccggcagtttccttcttacgca
aactga

DBGET integrated database retrieval system