KEGG   Acetobacter pasteurianus IFO 3283-12: APA12_07670Help
Entry
APA12_07670       CDS       T01814                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
apg  Acetobacter pasteurianus IFO 3283-12
Pathway
apg00020  Citrate cycle (TCA cycle)
apg00310  Lysine degradation
apg01100  Metabolic pathways
apg01110  Biosynthesis of secondary metabolites
apg01120  Microbial metabolism in diverse environments
apg01130  Biosynthesis of antibiotics
apg01200  Carbon metabolism
Module
apg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
apg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    APA12_07670
  Amino acid metabolism
   00310 Lysine degradation
    APA12_07670
Enzymes [BR:apg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     APA12_07670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: BAI20187
Position
798345..799586
Genome map
AA seq 413 aa AA seqDB search
MSVEIKVPTLGESVTTATVAKWLKQPGDAVQADEPIVELETDKVSVEVSAPQAGILGPQA
AKEDQEVEVGALLTTLEPAKAGAAPAAKAAAPEKKAEPVAAAAPAKAAAPAPKAAAPAPA
VDAGAALPAARKMMAENGLSAQQLAGTGLGGRITKGDVLGFLANPQAATPAAAPKPPRND
DPREERVKMTRLRRTIARRLKEAQNTAAMLTTFNEIDMSGAMALRAEYQDSFVKKHGVKL
GYMSIFSRAVVAALKEFPAINAEIDGDDVIYRDFVNLGIAVGGPNGLVVPVIRDADKMSY
AEIEKTIAGFGKAAREGTLKLDQLSGGTFSITNGGIYGSLLSTPILNAPQSGILGMHSIQ
ERPVAVNGQVVIRPMMYIALSYDHRIVDGKEAVSFLVRVKQNVEDPRRLLIEV
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcgagatcaaggtgccgacactgggtgaaagcgtaaccacagcaaccgtggcc
aagtggctgaagcagccgggcgacgcggtgcaggcagatgaaccgattgttgagctggaa
accgataaggtgagcgtggaagtttctgcgccgcaggctggtattctgggcccacaggct
gccaaggaagaccaggaagtagaagtgggcgcattgctgaccacgctggaacccgccaag
gctggcgctgcaccagccgccaaagccgctgccccggaaaagaaagcagaacccgtagcg
gctgccgctccggcaaaagcagccgcaccagcacctaaggccgcagccccggctccggca
gtagatgccggtgctgctctgcccgcagcccgcaagatgatggctgaaaacggcctgagc
gcacagcagcttgcaggcaccggccttggtggccgcattaccaaaggggatgtgctgggc
tttttggccaacccgcaggctgcaacaccagccgcagcccccaagccgccgcgtaatgat
gacccgcgcgaagaacgcgtgaagatgacgcgcctgcgccgcaccattgcccgccgcctg
aaggaagcacagaacacggcggccatgctgacaacgtttaatgaaatcgacatgtccggc
gccatggcgctgcgtgccgagtatcaggactcgtttgttaaaaagcacggtgtcaagctg
ggctatatgtccatcttctcccgcgctgttgtggctgccctgaaagagttcccggccatt
aacgcagaaattgacggtgatgatgtgatctaccgtgatttcgtaaacctcggcattgcc
gtgggtgggccaaacgggctggtggtgccggttatccgtgatgccgacaagatgagctat
gccgaaattgaaaaaaccattgcaggttttggcaaggcagcgcgtgaaggcacgttgaag
ctggatcagctttctggcggcaccttctccatcaccaatggcggtatttacggttctctg
ctgtccacccccatcctgaatgcacctcagtccggtattctgggcatgcactccattcag
gaacgcccggtggcagtgaacgggcaggtggtgatccgcccgatgatgtatattgccctt
tcttatgatcaccgcattgtagatggcaaggaagccgtcagcttccttgtgcgggtgaag
cagaacgtagaagacccgcgccgccttctgattgaagtctga

DBGET integrated database retrieval system