KEGG   Acetobacter pasteurianus IFO 3283-12: APA12_11890Help
Entry
APA12_11890       CDS       T01814                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
apg  Acetobacter pasteurianus IFO 3283-12
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:apg00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    APA12_11890
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    APA12_11890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1247235..1247753
Genome map
AA seq 172 aa AA seqDB search
MDGRFLNRIAVSAVLSAAVLATCVFAARSTVPDTAPARPAFSLPGLEPVPIAPLMAQANV
QRGGATVRQVCAQCHALAGGAAENAGPPLAGVAGRGVASCTGYTYSAALRQHAGQHWTDQ
MLADWLMAPARFAPGTRMSLTGIPDPAQRADVIAFLHTLGGQAAPAQAGCTP
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggatggcaggtttctgaacagaatagcggtttccgccgtgcttagtgcggcagtgctg
gcaacatgtgtgtttgctgcacgcagcaccgtgccagatacagcccctgcccgccctgct
ttttctttgccggggttggagcccgtacctattgctccgttaatggcgcaggccaatgtg
cagcgtggtggtgcaaccgtcaggcaggtttgcgcgcagtgccacgccttggctggtggg
gccgcggaaaacgccgggccgccgctagccggtgttgctgggcgtggtgtggcatcatgc
actggctacacctattctgcggcgttacggcagcatgcaggccagcattggacagaccag
atgctagcggattggcttatggcccctgcccgctttgcacccggcacacgtatgtctctc
actggtataccagatcccgcccaacgggcggatgttattgcatttcttcacactctcggc
gggcaggctgcgcccgcacaggcaggatgcacaccatga

DBGET integrated database retrieval system