KEGG   Acetobacter pasteurianus IFO 3283-12: APA12_18410Help
Entry
APA12_18410       CDS       T01814                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
apg  Acetobacter pasteurianus IFO 3283-12
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:apg00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1995622..1996233
Genome map
AA seq 203 aa AA seqDB search
MSVPPSDTSQRPTQAEAEQAVRTLLRWAGDNPDREGLHDTPARVARAYTEFFCGYEIDPA
ALLRRTFSEVEGYDEIVLLRDIRFESHCEHHLAPIIGRAHVAYLPRQRVVGISKLARVVD
AYAKRLQIQERLTAQIANTINDELEPHGVAVIIESSHECMTTRGVHKPGVSMVTSTMLGV
FRENSDTRRELMAMLNRPAACEF
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgcctccgtctgatacatctcaacgcccaacacaagccgaagcagaacaggct
gtacgcaccctgctacgctgggctggcgataacccggaccgtgaaggcctgcacgatact
cctgcccgtgttgcccgcgcttacaccgaatttttctgtgggtatgaaattgaccccgca
gccctgttacgccgcaccttttccgaagtggaagggtatgatgaaattgtgctgctgcgt
gatatccgctttgaaagccattgtgagcatcatctggcccccattatcgggcgtgcgcat
gttgcctatctgccgcgccagcgcgttgtaggcatttccaaactggcgcgtgtggtggat
gcctacgccaagcgcctgcaaattcaggaacggctcacggcccagattgccaacaccatc
aatgatgaactggaaccgcatggggttgccgttattattgaatcttcccacgaatgcatg
acaacacgcggcgtgcataaacccggtgtttccatggtcaccagcactatgctgggcgtt
tttcgggaaaattcagacacacggcgcgaactgatggcaatgctcaaccgccctgccgcc
tgcgaattctaa

DBGET integrated database retrieval system