KEGG   Acetobacter pasteurianus IFO 3283-12: APA12_18840Help
Entry
APA12_18840       CDS       T01814                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
apg  Acetobacter pasteurianus IFO 3283-12
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:apg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    APA12_18840
  Amino acid metabolism
   00330 Arginine and proline metabolism
    APA12_18840
Enzymes [BR:apg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     APA12_18840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2048129..2049256
Genome map
AA seq 375 aa AA seqDB search
MTGYTSPSLTNAKRLVVKIGSALVVDPEKQAPRQEWLASVAADIAYLRKQGTAVTVVSSG
AIALARHTLGLAGGALRLAEKQAAAAVGQISLAQAWSNALSAHGLIAAQLLLTPEDTEDR
KRYLNARATLNTLLEMGCVPVINENDTVATAEIRFGDNDRLAARVAQMTDSDQLVLLSDI
DGLYTADPRTNPDAQHLPVIETLTPEIEAMGGEPPPGYSSGGMRTKLLAAGIATRSGCAM
AIALGKTPHPLRSLLEGGRCSWFLPQDCAHTARKQWIAGSLTPAGEIMVDDGAVTALQQG
KSLLPAGVLGVKGDFSQGDLVEIINTDGIVLAHGLAAYDADDARRIAGHRSTELTDILGW
HGRDEIIHRDDLVMI
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaccggatacaccagcccctcccttaccaatgccaaacggcttgttgttaaaataggt
agcgcgctggtggtggacccagaaaaacaggctcctcgtcaggaatggctggccagtgtg
gcggcagatattgcgtatctgcgcaaacagggcacggctgttactgttgtatcttctggc
gctattgcacttgcccggcacacattgggtttggctggtggcgcgctccgtttggcagaa
aaacaggcagccgctgctgtagggcagatcagtctggcgcaggcatggagcaatgctctt
tcggcccacggccttattgccgcccagcttctgctgaccccggaagatacagaagaccgc
aaacgctacctgaatgcacgcgcaacgctgaataccctgctggaaatggggtgcgttccc
gtaattaacgagaacgataccgttgccacagccgaaattcgttttggcgataatgacagg
ctggcagcccgcgttgcacaaatgacggactcggaccagcttgtgctgctgtctgatatt
gatggcctctacacggctgacccacgcacaaacccggatgcacagcatctgcccgtgatt
gaaacccttaccccggaaattgaagccatggggggggaacctccgccgggttattcttct
gggggtatgcgcaccaagctgttggctgcgggcattgctacacgctcgggctgtgccatg
gctattgccttgggtaaaacgccccacccgctccgctctttgctggaaggtgggcgctgc
tcatggttcttgccgcaagattgcgcccatacagcccgcaagcagtggattgcaggcagc
ctgacaccagcaggtgaaattatggtggatgatggtgccgtaaccgcattacagcagggc
aaatctcttttgccagcaggtgtgcttggggtgaagggtgatttctctcagggtgatctg
gtagaaattatcaatacggatggcatcgtgctggctcatgggcttgccgcctatgatgca
gacgatgcccggcgcattgcaggccaccgctccaccgagcttacagatattttgggatgg
cacggacgggacgagatcatccatcgtgatgacctcgtcatgatctag

  All links  
No link information was found.   
DBGET integrated database retrieval system