KEGG   Acetobacter pasteurianus IFO 3283-12: APA12_19380Help
Entry
APA12_19380       CDS       T01814                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
apg  Acetobacter pasteurianus IFO 3283-12
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:apg00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2112700..2113704
Genome map
AA seq 334 aa AA seqDB search
MMAGRFPLARPRRNRIDDFTRRLVAENTLGINNLIWPIFFMEGTNTITEVSSMPGVHRVT
LDKLAAHVEPAAKLGIPALALFPITPTEARDEKGTEATNPDNLMCRAARLLKKEFPEVGL
IGDVALDPYTSHGHDGLIENGYVVNDPSVTILSQQAVNQAAAGVDIIAPSDMMDGRIEAI
RRDLDGNGLINTRIMSYAAKYASAFYGPFRDALGSGGMLKGDKKTYQMDPANSDEALREV
EMDIAEGADMVMVKPGLPYLDIIRRVKDEFHVPTFAYQVSGEYAMLMAAIRNGWLDHERA
VMESLLAFRRAGANGILTYFAIEAAERIRASFGQ
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgatggctggccgttttcctctggctcgcccccggcgcaaccggattgatgatttcacg
cgccgtttggttgctgaaaatacgttgggcatcaacaatctgatctggcctatctttttt
atggaaggcaccaacacgattaccgaggtgtcctccatgcccggcgtacaccgtgttacg
ctggacaagctggccgcacatgttgagcccgccgcaaagctgggtattccagctttggcc
ctgtttcccatcacgcccacagaagcgcgagatgaaaaaggcacggaagccacaaacccg
gacaacctgatgtgccgggccgcccgcctacttaaaaaggaatttccggaagttgggctg
attggtgacgtggcgctagacccctataccagccacggccacgatggcctgattgaaaat
ggctacgtggtgaatgatccatccgtaaccattctttctcagcaggccgttaatcaggct
gctgctggtgtggacattattgccccgtcagacatgatggatggccgtattgaagctatt
cggcgtgatctggacggcaatgggctgatcaacacccgtatcatgtcctacgctgccaag
tatgccagcgccttttatggcccgttccgtgatgctctgggttctggcggcatgctgaaa
ggtgataaaaaaacctatcagatggacccagccaacagcgatgaagccctgcgcgaagtg
gaaatggacattgctgaaggcgcagacatggttatggtcaaacccggcctgccatatctg
gatatcatccgccgtgtgaaggatgaattccacgtacctacctttgcctatcaggtatct
ggtgaatatgcgatgctgatggcggccatccgcaatggctggctggaccatgaacgcgcc
gttatggaaagccttctggccttccgccgcgctggcgccaatggcattttaacgtatttt
gctattgaagctgcagaacgtatccgggcatctttcggccaatag

DBGET integrated database retrieval system