KEGG   Acetobacter pasteurianus IFO 3283-12: APA12_20810Help
Entry
APA12_20810       CDS       T01814                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
apg  Acetobacter pasteurianus IFO 3283-12
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:apg00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2261688..2263916)
Genome map
AA seq 742 aa AA seqDB search
MPARSVSKNRKMADLVLQKQIEELASGHSSNPFAVLGRHPDGRGDIVRVFFPDAFEVRVV
ITSADGSTLERQMQRIHPHGVYSVTIPKRSQSYFVRVKWADSWQDVVDPYSFGKLLGDLD
LHLFSEGRHQSPDAIMGAHCVEIHGVKGVRFTVWAPNARRVSVIGDFNIWDGRRHPMRLR
HGAGVWELFVPGLIAGERYKYEILSAEGKVLPAKADPYARFTEKPPATASRVAAPIIHEW
HDADWMAQRHEFHKVNAPLSIYEIHAPSWRSPESGQGFVSWGGLADALIPYIQELGFTHI
ELLPITEYPFSGSWGYQPVSMYAPTARHGEPQEFAAFVDRCHQAGIGVIMDWVPAHFPSD
PHGLACFDGTHLYEHADPQEGFHQDWHTLIYNFGRNEVRGFLLGSAFYWLKHFHIDGLRV
DAVASMLYRDYSRKEGEWKPNIYGGCENLEAVSFFHELSALMRDMYDDVMLIAEESTAWP
GVTMPSEAGGLGFRFKWNMGWLHDTLRYMQRNPLWRGYHANDLSFGMIYAYSERFILPLS
HDEVVHGKGSLLSRMPGDEWQKHANLRSLYALMWAYSGKQLLFMGGELAQWEEWNHDGQI
AWHRLDEASGKGVYNTVVALNRLYRSYPALYAEDYNPRGFQWVIADDAQNCVFAWLHYAP
DAAPVLVVCNMTPVPRHNYRVGVPQGGYWHEILNTDAACFGGSNVGNAGGLHAQDVPAHG
MCCSLDATLPPLAVLYFSPVAP
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctcgttctgtatctaaaaatcgtaaaatggctgatttagtgcttcaaaagcaa
attgaagagcttgcatcagggcatagctctaatccttttgctgtgttgggccgccaccct
gatgggcggggtgacattgtgcgtgtctttttccccgatgcgtttgaagtccgggtagtc
attacttcagcagatggatctacgcttgagcggcagatgcagcgtattcatcctcatggc
gtgtatagcgttaccatccccaagcgcagtcaaagttattttgtgcgcgtgaagtgggct
gatagttggcaagatgttgttgacccgtacagctttggcaaactgttgggagatctagac
ctacatctgttttcagaaggacgtcatcagtccccagatgcaataatgggagcgcattgt
gttgagatacatggcgtaaaaggtgtgcgctttacggtttgggcgcctaatgctcgcagg
gtgtctgttattggggatttcaatatatgggatggcagacgtcatcccatgcggttgcgg
catggagccggagtgtgggagttgtttgttcccggccttatagctggggaacgttataaa
tatgaaattctttctgctgaaggaaaagttttgccggcaaaggcagatccttatgctcgg
tttacggaaaagcctccagccacggcatcacgtgttgctgcaccaataatccatgaatgg
catgatgcagattggatggcgcaacggcatgaatttcataaagtgaatgcgccgttatct
atttatgaaattcatgccccttcttggagatcgccagaaagcggccaagggtttgtgtct
tggggtggtttggccgatgcactcatcccttatatccaggaacttgggtttacccatata
gaacttcttccgattacagaatatccgttttctggatcatgggggtatcaacccgtcagt
atgtatgccccaacggctcgccatggggagccgcaggagtttgctgcatttgtagatagg
tgccatcaggctggtattggggtgattatggattgggtgccagctcattttccttctgat
ccgcacgggcttgcatgttttgatggtacacatctgtacgaacatgcagacccacaggag
ggatttcaccaggattggcacacgcttatttataattttggccggaatgaggtgcggggt
ttcctgctgggaagtgccttttattggctgaagcactttcatattgatggtctgcgggtc
gatgccgtggcgtccatgttgtatcgggattacagccgaaaggaaggggagtggaaacct
aatatttacggtggatgtgaaaatcttgaagctgtctcattttttcatgaactctctgcc
ctcatgcgagatatgtatgatgatgtgatgctgatagctgaagagtccacggcatggccg
ggtgtgaccatgccttctgaagcaggcgggttagggtttcgttttaagtggaatatgggg
tggttgcatgacactttgcgttacatgcagcggaatccactttggcgcgggtatcatgca
aatgatctgagcttcggcatgatctatgcctattctgagcgttttattctaccactttct
catgatgaagttgtgcatggcaaaggttctctcttgtcgcgcatgccaggcgatgagtgg
cagaaacatgctaatttacgatctctctacgcgcttatgtgggcatattcaggcaagcaa
ctcctttttatgggaggcgagttagcgcaatgggaagaatggaaccacgatggccagatt
gcctggcacaggctggatgaggcatccggcaagggggtgtataatacggttgtagccctc
aatcgcctctatcgttcttatccggctctatatgcggaggattacaatcctcgtggcttt
cagtgggtgattgcggacgatgcgcaaaattgtgtttttgcctggttacactatgcgcca
gacgcggcacctgttctggttgtttgtaatatgacacctgtgccccgccacaattatcgg
gtgggtgttccacagggtggatactggcacgaaattctcaataccgatgccgcatgtttt
ggtgggtctaatgttggcaatgctggtggtctgcatgcgcaggatgtgcctgcccacggg
atgtgttgttctttagatgcaacgctcccaccacttgctgttttgtatttcagtccggtt
gctccctag

DBGET integrated database retrieval system