KEGG   Acetobacter pasteurianus IFO 3283-12: APA12_22590Help
Entry
APA12_22590       CDS       T01814                                 

Definition
3-hydroxyisobutyryl-CoA hydrolase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
apg  Acetobacter pasteurianus IFO 3283-12
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:apg01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:apg00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:apg00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:apg00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:apg00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:apg00310]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:apg00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:apg00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:apg00410]
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:apg00903]
Metabolism; Metabolism of terpenoids and polyketides; Geraniol degradation
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:apg00627]
Metabolism; Xenobiotics biodegradation and metabolism; Caprolactam degradation [PATH:apg00930]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2455691..2456710)
Genome map
AA seq 339 aa AA seqDB search
MTEQTLSAVSGVRMQQEGHLGRIILDRPKRLNAVDISMASGIKAALQTWRDDPSIHTILL
ESSSTRAFCAGGDLRAIHDCLKAQGALAAYELMKRVYDVMLLLADYKKPIVSFLDGVAMG
GGIGLGGHVRYRVVTETSVLAMPETAIGLAPDAGGSWLLARAPGFSGLRRAVTGGRMNGA
EAVAMGFADVLVSSASLADLRETLSIESAEHVFARLHSQPESLDVQNLDSCYNAPDILQV
IEKLKAEGSEDAQEDLEALSRACPFSVQVAWSGWHRARAASSLHEAFTLEENMVHHMVAR
PDFAEGIRARLIDKDNSPAWVPPALAEVNEQEVQNCFDK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacagagcaaactctttccgccgtatctggcgtaagaatgcagcaagaagggcattta
gggcgtattattttagaccgtcccaaacggttgaatgctgtggatatcagtatggccagt
ggcataaaggccgctttacagacatggcgggatgatccgtctattcacactattcttctg
gaaagcagcagcacgcgtgccttttgcgccgggggagacctacgcgccattcatgattgc
ctaaaagctcaaggggcattggcagcatatgaacttatgaagcgcgtatatgatgtcatg
ctgctgttggcagattacaaaaaacccattgtttcctttttagatggcgtagctatgggc
ggcggtattggcttgggtggtcatgtacgatatcgagtagttacggaaacatctgtgctg
gctatgcctgaaactgctattggtctggccccggatgctgggggaagctggctgttagcc
cgcgctcctggtttttctggcttacggcgtgccgttactggtgggcgtatgaacggggca
gaggctgtggccatggggtttgctgatgttttggtttcatcggcttctcttgcagattta
agagagacgttgagtattgaaagtgcagaacatgtatttgcacgcctccattcccagccc
gaaagcctagacgtgcaaaatctggattcctgttacaatgcgccagatatcttgcaggtt
attgaaaagctgaaagcggaaggatcagaagatgcgcaagaggaccttgaagcgttatca
cgtgcctgtccgttttctgtgcaggtagcatggtctggatggcaccgggcgcgtgcagct
tcctcattacatgaggcttttacacttgaggaaaacatggtgcaccatatggtagcccgg
cccgattttgcagaaggtattcgagcccgcttgattgataaagataatagtcctgcgtgg
gtgcctcctgctttggcggaagtgaatgagcaggaagttcaaaattgttttgataagtaa

DBGET integrated database retrieval system