KEGG   Anaplasma phagocytophilum HZ: APH_0180Help
Entry
APH_0180          CDS       T00327                                 

Gene name
cycM
Definition
(GenBank) cytochrome C, membrane-bound
  KO
K08738  cytochrome c
Organism
aph  Anaplasma phagocytophilum HZ
Pathway
aph01100  Metabolic pathways
aph01120  Microbial metabolism in diverse environments
aph02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aph00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    APH_0180 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ABD44146
UniProt: Q2GLE8
Position
complement(180220..180744)
Genome map
AA seq 174 aa AA seqDB search
MGGYNLNRLATAILFASFIVLVVSNVVDLVYHPDYSGPRGYSVDVPTTQSAGSVPGAVAP
IVDIAALMENASAEKGKAVAKKCSACHTFNKGGPHRVGPNLWGVVGSKQARAQDFPYSKA
LLSKGGTWSEEELFKFLDSPRNYANGTRMAFAGLKPKDIADVLAYFKSLEKEGT
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtgggtggctataatttaaataggcttgctactgccatcctttttgcgtctttcatcgtc
cttgttgtgagcaatgtggtggaccttgtgtaccatcccgactatagcggacctcgtgga
tacagtgtagatgtacccacaacgcagtctgcaggtagcgtgcctggagctgttgcacct
attgtcgatattgctgcactcatggaaaatgcaagtgccgagaagggtaaggcggttgct
aaaaagtgttccgcttgtcatactttcaacaagggcggtcctcacagggtgggtcctaat
ttatggggcgtagttggctcgaagcaagcccgtgctcaagatttcccttattctaaggct
ttattgagtaagggtggtacttggagtgaggaagagctgtttaagtttcttgacagccct
agaaattacgctaacggtactcgcatggcatttgctggactgaagcctaaagacattgcg
gatgtattggcgtattttaagtctctagaaaaggaaggtacttaa

DBGET integrated database retrieval system