KEGG   Anaplasma phagocytophilum HZ: APH_0180Help
Entry
APH_0180          CDS       T00327                                 

Gene name
cycM
Definition
cytochrome C, membrane-bound
Orthology
K08738  
cytochrome c
Organism
aph  Anaplasma phagocytophilum HZ
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:aph00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:aph02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(180220..180744)
Genome map
AA seq 174 aa AA seqDB search
MGGYNLNRLATAILFASFIVLVVSNVVDLVYHPDYSGPRGYSVDVPTTQSAGSVPGAVAP
IVDIAALMENASAEKGKAVAKKCSACHTFNKGGPHRVGPNLWGVVGSKQARAQDFPYSKA
LLSKGGTWSEEELFKFLDSPRNYANGTRMAFAGLKPKDIADVLAYFKSLEKEGT
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtgggtggctataatttaaataggcttgctactgccatcctttttgcgtctttcatcgtc
cttgttgtgagcaatgtggtggaccttgtgtaccatcccgactatagcggacctcgtgga
tacagtgtagatgtacccacaacgcagtctgcaggtagcgtgcctggagctgttgcacct
attgtcgatattgctgcactcatggaaaatgcaagtgccgagaagggtaaggcggttgct
aaaaagtgttccgcttgtcatactttcaacaagggcggtcctcacagggtgggtcctaat
ttatggggcgtagttggctcgaagcaagcccgtgctcaagatttcccttattctaaggct
ttattgagtaagggtggtacttggagtgaggaagagctgtttaagtttcttgacagccct
agaaattacgctaacggtactcgcatggcatttgctggactgaagcctaaagacattgcg
gatgtattggcgtattttaagtctctagaaaaggaaggtacttaa

DBGET integrated database retrieval system