KEGG   Anaplasma phagocytophilum HZ: APH_0180Help
Entry
APH_0180          CDS       T00327                                 

Gene name
cycM
Definition
cytochrome C, membrane-bound
Orthology
K08738  
cytochrome c
Organism
aph  Anaplasma phagocytophilum HZ
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:aph00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    APH_0180 (cycM)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    APH_0180 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(180220..180744)
Genome map
AA seq 174 aa AA seqDB search
MGGYNLNRLATAILFASFIVLVVSNVVDLVYHPDYSGPRGYSVDVPTTQSAGSVPGAVAP
IVDIAALMENASAEKGKAVAKKCSACHTFNKGGPHRVGPNLWGVVGSKQARAQDFPYSKA
LLSKGGTWSEEELFKFLDSPRNYANGTRMAFAGLKPKDIADVLAYFKSLEKEGT
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtgggtggctataatttaaataggcttgctactgccatcctttttgcgtctttcatcgtc
cttgttgtgagcaatgtggtggaccttgtgtaccatcccgactatagcggacctcgtgga
tacagtgtagatgtacccacaacgcagtctgcaggtagcgtgcctggagctgttgcacct
attgtcgatattgctgcactcatggaaaatgcaagtgccgagaagggtaaggcggttgct
aaaaagtgttccgcttgtcatactttcaacaagggcggtcctcacagggtgggtcctaat
ttatggggcgtagttggctcgaagcaagcccgtgctcaagatttcccttattctaaggct
ttattgagtaagggtggtacttggagtgaggaagagctgtttaagtttcttgacagccct
agaaattacgctaacggtactcgcatggcatttgctggactgaagcctaaagacattgcg
gatgtattggcgtattttaagtctctagaaaaggaaggtacttaa

DBGET integrated database retrieval system