KEGG   Anaplasma phagocytophilum HZ: APH_0354Help
Entry
APH_0354          CDS       T00327                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
aph  Anaplasma phagocytophilum HZ
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    APH_0354
Enzymes [BR:aph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     APH_0354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
344436..345128
Genome map
AA seq 230 aa AA seqDB search
MLLLTRAMCDSVKSRDALIALGFDVFIEPMFEVRYLAAEITGLEGYEVVLATSRHGIIGM
AQATDNRSIPIVTVGDSSMKHALSLGFQNVKTVSGTAEDLLHYLRTKSYSSKVLYIRGTN
ISHDLSKMARNFGITVEELILYETIRSTELSPECCYLLSKRKISGVLFYSMETAKIFMNL
VEKKYKECLATVAAYTISSRVCDALNTCKWKGVLVSESPTEESLFRLLLK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctgacgcgtgctatgtgtgactctgtgaagtcgagagacgctctaattgcg
ctggggtttgacgttttcatcgagcccatgtttgaggtacgttatcttgccgcagaaata
acggggctagaaggctacgaagttgttttagctactagcagacatggcattattggaatg
gcacaagctactgataatagaagcattcccattgtcactgtgggtgatagctctatgaag
catgcacttagtttaggattccaaaatgttaaaacggtgagcggtacagcagaggatctc
ctgcattatctgagaacgaaatcatatagttctaaagtgctatatatccggggtacaaat
atttcgcatgacttaagtaagatggccagaaactttgggattaccgtcgaagagttgata
ctatacgagacgataaggagcactgaactgagccctgagtgttgttatttgctgagtaag
aggaaaatttcaggagtactgttttattctatggaaaccgcgaaaatttttatgaactta
gtggaaaagaagtacaaagagtgtctcgctactgtggctgcatacaccattagtagcagg
gtatgtgatgctctgaatacgtgcaagtggaaaggcgtgcttgtgtcagaatctcccacg
gaagaatcattatttagattactattgaaataa

DBGET integrated database retrieval system