KEGG   Anaplasma phagocytophilum HZ: APH_0469Help
Entry
APH_0469          CDS       T00327                                 

Definition
putative malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
aph  Anaplasma phagocytophilum HZ
Pathway
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aph00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    APH_0469
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    APH_0469
Enzymes [BR:aph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     APH_0469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
496085..497470
Genome map
AA seq 461 aa AA seqDB search
MENSLLKIKYRTISSVVKVFDEVTDVVLSWVGNIGKDLSRKQDIDNLLSKMRECVSPKGG
EVKARYNTISLGNLYLQLSDVGKARFLRMLNDRFNSTQEEVDSKISEYVNNTDSALEEKL
RFELISVLSSPRLSILKQFMSLSEGVKFLVDMRADAITLSRKGENFFALERDLKGVLSSL
FDVGLLELRHITWDSPASLLEKLIFYEAVHAISSWEDLRHRLESDRRCFAFFHYKMPQEP
LIFVEVALVNDVANSVQALLDDSAPKKDPSEAKVAIFYSISNTQVGLTGISLGNFLIKRV
VSRLSSEFSNIKTYATLSPIPGFVRWLNEVLASDGDAFLRSVGISHSVEGLQSYINSISS
DPKSIPVVSQELLLRLCAHYLNTKSGSRVIDPVAHFHLSNGASIRRLNWMADTSQKGLLS
SLGIMVNYSYELSKIDDNHEAYVVHGKVTYSREIATLLKKS
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaactccctactgaagataaaatacaggacgattagcagtgtagttaaggtattt
gacgaggtgaccgacgttgtattatcgtgggttggtaatataggcaaagacttatctagg
aagcaagatatagacaatctcttgagcaagatgcgcgagtgcgtaagcccaaagggaggg
gaagttaaggctagatacaatactatatcgttgggtaatctttatctacagctgtctgat
gtgggcaaggcaaggttcttgcggatgttgaacgatagattcaactctacacaggaagaa
gtagatagcaagattagtgagtatgttaataatacagacagtgctctagaagaaaagctt
agattcgagctgatttcagttttgtcctctcctaggctgagtatcttaaagcagtttatg
tccttatctgaaggggtgaaatttcttgtagatatgagggcggatgctattacgctttcg
agaaagggggagaattttttcgcattggagagagatctaaaaggagtactttcttcgtta
tttgatgtgggcttattagagctgcgtcacatcacttgggattctcctgcgtcactgttg
gaaaagctcatattttatgaagcagtgcatgcgatttcttcgtgggaggatttgcgtcat
aggttggagtctgatcgcaggtgttttgcatttttccactataagatgcctcaagaacct
ttaatatttgttgaggtggcattggtaaacgatgttgcaaatagtgtgcaggcgttgctt
gatgatagtgctccgaaaaaggatccgtctgaggctaaagttgcgattttctactctatt
tccaatacgcaggttgggcttactgggattagtttaggcaattttctcatcaaaagagtg
gtgagcaggctttccagtgagtttagtaacattaaaacttatgctactctctcgccgata
ccgggatttgtcaggtggctcaatgaggttttggcatcagatggcgatgcgttcttgcgc
agtgtaggtatatctcattctgttgaagggttgcaaagttatataaattccattagtagc
gatcctaagagtattcctgttgtgtctcaggagttattgctaaggctatgtgcgcactat
ttaaatactaagagtggtagtagggttatcgatcctgttgctcattttcatcttagtaat
ggtgcatctattaggcgactaaattggatggctgatacttctcaaaagggtttgctgagt
tctttggggattatggttaattacagttatgagttgtctaaaattgatgataatcatgag
gcctatgttgtgcatgggaaggtcacatattctagagaaatagctactcttttgaagaaa
agttga

DBGET integrated database retrieval system