KEGG   Anaplasma phagocytophilum HZ: APH_0624Help
Entry
APH_0624          CDS       T00327                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aph  Anaplasma phagocytophilum HZ
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    APH_0624 (tpiA)
   01230 Biosynthesis of amino acids
    APH_0624 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APH_0624 (tpiA)
   00051 Fructose and mannose metabolism
    APH_0624 (tpiA)
   00562 Inositol phosphate metabolism
    APH_0624 (tpiA)
Enzymes [BR:aph01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     APH_0624 (tpiA)
Exosome [BR:aph04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   APH_0624 (tpiA)
  Exosomal proteins of bladder cancer cells
   APH_0624 (tpiA)
  Exosomal proteins of melanoma cells
   APH_0624 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
650446..651252
Genome map
AA seq 268 aa AA seqDB search
MVERLTCNQDVVGSSPAVGSLCVIIMDDMSFLVVANWKANGNARLAESFLDVLSSQNSLS
GGSTCSVVLCPPYTAMPSLRGRSCVVRLGGQDCFAGVSRGCTGEITAKMLRECGCEYVIL
GHSDRRTLLNESDSLIKLKAESAIGECLIPIICVGENREERESGATGRVLLEQCRSCLPE
EGEFFVAYEPIWAIGGSVIPDIAMIEEAFSIIKSHNPGLRIIYGGSVNESNIRSLKTGVS
GIAGVLVGSASLDADGFARMLDNVMECL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
ttggtagagcgcctgacttgtaatcaggatgttgtcggttcgagtccggcagtcggctct
ctctgtgtaattattatggatgatatgtcctttcttgttgttgcgaattggaaggctaac
ggtaatgcaaggctagctgaaagtttcttggatgttctgtcttctcaaaactcattatca
ggtggttctacgtgcagcgtggtgttgtgtcctccatatactgctatgccttcattaagg
gggcgaagttgtgtagttaggttaggtgggcaggactgttttgctggggtgagtcgtggt
tgtaccggtgaaatcactgctaaaatgctgcgggaatgtggctgtgaatatgtaatacta
gggcactctgaccggcggactctacttaatgagagtgactctttgataaagcttaaggct
gagagtgctataggagaatgccttattccgataatatgtgtgggagaaaatagggaagag
cgagaaagtggtgctactggaagggttttattggagcaatgccgaagttgtcttcctgaa
gagggggagttttttgttgcgtatgaacctatatgggctataggtggttctgttatccct
gatattgcgatgatagaggaggctttttctatcattaagtcgcataatcctgggcttcgt
atcatatatggtggttctgtaaatgagagtaacatacgctcgctgaaaacaggtgttagt
ggtatcgctggggtattagtgggtagtgctagtctagatgctgatggatttgctagaatg
ttggataatgtgatggaatgcttatag

DBGET integrated database retrieval system