KEGG   Anaplasma phagocytophilum HZ: APH_0624Help
Entry
APH_0624          CDS       T00327                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aph  Anaplasma phagocytophilum HZ
Pathway
aph00010  Glycolysis / Gluconeogenesis
aph00051  Fructose and mannose metabolism
aph00562  Inositol phosphate metabolism
aph01100  Metabolic pathways
aph01110  Biosynthesis of secondary metabolites
aph01120  Microbial metabolism in diverse environments
aph01130  Biosynthesis of antibiotics
aph01200  Carbon metabolism
aph01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APH_0624 (tpiA)
   00051 Fructose and mannose metabolism
    APH_0624 (tpiA)
   00562 Inositol phosphate metabolism
    APH_0624 (tpiA)
Enzymes [BR:aph01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     APH_0624 (tpiA)
Exosome [BR:aph04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   APH_0624 (tpiA)
  Exosomal proteins of bladder cancer cells
   APH_0624 (tpiA)
  Exosomal proteins of melanoma cells
   APH_0624 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABD43722
UniProt: Q2GK90
Position
650446..651252
Genome map
AA seq 268 aa AA seqDB search
MVERLTCNQDVVGSSPAVGSLCVIIMDDMSFLVVANWKANGNARLAESFLDVLSSQNSLS
GGSTCSVVLCPPYTAMPSLRGRSCVVRLGGQDCFAGVSRGCTGEITAKMLRECGCEYVIL
GHSDRRTLLNESDSLIKLKAESAIGECLIPIICVGENREERESGATGRVLLEQCRSCLPE
EGEFFVAYEPIWAIGGSVIPDIAMIEEAFSIIKSHNPGLRIIYGGSVNESNIRSLKTGVS
GIAGVLVGSASLDADGFARMLDNVMECL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
ttggtagagcgcctgacttgtaatcaggatgttgtcggttcgagtccggcagtcggctct
ctctgtgtaattattatggatgatatgtcctttcttgttgttgcgaattggaaggctaac
ggtaatgcaaggctagctgaaagtttcttggatgttctgtcttctcaaaactcattatca
ggtggttctacgtgcagcgtggtgttgtgtcctccatatactgctatgccttcattaagg
gggcgaagttgtgtagttaggttaggtgggcaggactgttttgctggggtgagtcgtggt
tgtaccggtgaaatcactgctaaaatgctgcgggaatgtggctgtgaatatgtaatacta
gggcactctgaccggcggactctacttaatgagagtgactctttgataaagcttaaggct
gagagtgctataggagaatgccttattccgataatatgtgtgggagaaaatagggaagag
cgagaaagtggtgctactggaagggttttattggagcaatgccgaagttgtcttcctgaa
gagggggagttttttgttgcgtatgaacctatatgggctataggtggttctgttatccct
gatattgcgatgatagaggaggctttttctatcattaagtcgcataatcctgggcttcgt
atcatatatggtggttctgtaaatgagagtaacatacgctcgctgaaaacaggtgttagt
ggtatcgctggggtattagtgggtagtgctagtctagatgctgatggatttgctagaatg
ttggataatgtgatggaatgcttatag

DBGET integrated database retrieval system