KEGG   Anaplasma phagocytophilum HZ: APH_0814Help
Entry
APH_0814          CDS       T00327                                 

Definition
GTP cyclohydrolase I, internal deletion
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
aph  Anaplasma phagocytophilum HZ
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    APH_0814
Enzymes [BR:aph01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     APH_0814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
864306..864806
Genome map
AA seq 166 aa AA seqDB search
MAEVTQCGRVCPTIEEAEEAVRVIIRWMGDDPNREGLLKTPRRVLDYYKKSCSGYAPELL
SHYSILPYDGSSSEMVLVKNIGFSSNCEHHLSPICGVAHIAYMPKEKILDPHGVAVLLEA
EHWCVECSNRDTASRDERLNVQTSQMLGVFEERCDLRNEFFLRIKM
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtaacgcaatgtggtagagtttgtccaacgattgaagaagctgaagaggcg
gttagagtcataataaggtggatgggggatgatcctaatagggagggtttattaaaaacg
cctcgtagggtcttggattactataaaaagtcttgttctggttatgctcctgagcttctc
tctcactattctattcttccctatgatgggagtagttcagaaatggtgttggtgaagaac
atagggttttcttcaaactgcgaacatcatcttagtcctatatgtggtgtggcgcatatc
gcttatatgccaaaagagaagatactagatcctcatggtgttgctgtactactagaggcc
gagcattggtgcgttgaatgtagcaacagggatactgcctctagagatgagaggttgaat
gtacaaactagtcaaatgttaggggtttttgaagagcgttgtgatttgcgcaatgaattc
ttcttaagaattaaaatgtaa

DBGET integrated database retrieval system