KEGG   Anaplasma phagocytophilum HZ: APH_0988Help
Entry
APH_0988          CDS       T00327                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
aph  Anaplasma phagocytophilum HZ
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aph00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    APH_0988 (recR)
DNA repair and recombination proteins [BR:aph03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      APH_0988 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1046524..1047108
Genome map
AA seq 194 aa AA seqDB search
MDISRLISLFSKLPGLGPASSRRIVLHLLRHRHDVMTPLANGIRELEESTKECEICFNLD
VTSPCSICTDSRRDKSLLCIVEELGDLWAFEKGRIYQGMYHVLGGVLSALSGVGPEDLNM
SSIPERVRLHGVKEVIVATGSDMDGQVTCHYIAQSIKSTGVKVTRLACGIPLGGEIDYLD
EGTLRAALSSRYII
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggacataagtagattaattagtttattctctaagcttcctggtttagggcctgcttct
tcacgcaggattgttctacaccttcttcgacacagacatgacgttatgacacccctagcc
aatggcatcagggaattggaagaaagtacaaaagaatgcgaaatctgttttaatttggat
gtgacttctccatgtagcatatgcaccgatagcagacgtgacaagagtttgctttgcatc
gtcgaggaattgggtgatttgtgggcttttgaaaaaggaagaatatatcaaggtatgtac
cacgtgctcggtggtgttctatcagcgttgtctggtgtgggccctgaagacttaaatatg
agcagcatacccgagagagtcaggttacacggtgtaaaagaagtgatagttgctaccggc
agtgatatggatggtcaggtaacgtgtcactacattgcgcaatcaataaagagtacagga
gttaaggttacgaggctcgcatgcggtattcctctaggtggtgagatagactatctagat
gagggaacgcttcgtgcagcgttatcttcacgctatatcatatag

DBGET integrated database retrieval system