KEGG   Anaplasma phagocytophilum HZ: APH_0998Help
Entry
APH_0998          CDS       T00327                                 

Gene name
sdhD
Definition
succinate dehydrogenase, hydrophobic membrane anchor protein (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
aph  Anaplasma phagocytophilum HZ
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:aph01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:aph00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:aph00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1056603..1056932)
Genome map
AA seq 109 aa AA seqDB search
MSGKSILHWWMQRMTAVVMLPVPIFLVKALLVSDFATGLLDLTHGYKGALTALFLMPAFY
HGVLGVQVVLEDYVRSDALRAFLITFIKLFAVLTVCVFSLVVLLRTLGM
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaaagagtattttacactggtggatgcagcggatgactgcggtggtaatgctg
ccggttccaatattccttgtgaaggcgttattagtttctgattttgctacggggcttcta
gatttaacgcatgggtacaagggggcattgactgctttatttttgatgccggctttttat
catggtgttttgggtgtgcaggttgtcttggaggattatgtgcgctctgatgcgctacga
gcttttctgattactttcataaaattatttgctgtactaacagtttgtgtattttctttg
gtggtgttgctgcgtacgctaggtatgtag

DBGET integrated database retrieval system