KEGG   Anaplasma phagocytophilum HZ: APH_1198Help
Entry
APH_1198          CDS       T00327                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aph  Anaplasma phagocytophilum HZ
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    APH_1198 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    APH_1198 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    APH_1198 (sucB)
Enzymes [BR:aph01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     APH_1198 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1266220..1267440
Genome map
AA seq 406 aa AA seqDB search
MGDAVEVRAENLGGESILEAPIRVMKKVGDTVSAEDVLFIVETDKTSLEISAPVAGVLTE
LRVADEEVITKGQVLAIIRPQGEATAEGVNKEPESKEEVPAQPVVAQAVSTQKPQEKTII
EGKGLVTPTVEDFVAGINTTPTSRALGMSAKSEQDKKIVASQPSKDLMSCHGDVVGERRV
KMSKIRQVIAARLKESQNTSATLSTFNEVDMSKVMELRAKYKDAFVKRYDVKLGFMSFFI
RAVVLVLSEIPVLNAEISGDDIVYRDYCNIGVAVGTDKGLVVPVIRRAETMSLAEMEQAL
VDLSTKARSGKLSVSDMSGATFTITNGGVYGSLLSTPIINPPQSGILGMHAIQQRPVAVD
GKVEIRPMMYLALSYDHRIVDGQGAVTFLVRVKQYIEDPNRLALGI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgctgtagaagttagggctgagaatcttggtggcgaatccattctagaagct
ccgattcgggtaatgaaaaaggtgggagatactgtatctgcagaagatgtgctcttcatt
gttgaaacagacaagacttctcttgaaatatcagcccctgttgctggtgttctcacagag
ttgagagttgcagatgaagaagtgattaccaaggggcaggtcttggctatcatacggcca
cagggtgaggctactgcagagggtgttaataaggagccagagagcaaggaggaggtgcct
gctcaacccgttgttgcacaggcagtgagcactcaaaaaccgcaggaaaagacaattatt
gaaggcaaaggtctagtaactcctactgtagaagattttgttgcaggaatcaacacaact
cctacttctagagctttgggtatgagtgctaagagtgaacaagacaagaagatagttgct
agccagccgtctaaggatctgatgagttgccatggcgacgtggtgggtgaaagacgcgtg
aagatgagcaaaatccgccaagttatagctgctaggcttaaggagtcacaaaatacctct
gctacactcagcacctttaatgaagttgatatgagcaaagtgatggagctcagagctaag
tacaaagatgcctttgtgaagaggtatgatgttaagcttgggtttatgtccttctttatc
agagcggttgtgctagtcctttccgaaattcctgtgctgaatgcggagatttcaggcgat
gatatagtctacagggactattgtaacattggagtcgcggtaggtaccgataaggggtta
gtggtgcctgttatcagaagagcggaaactatgtcacttgctgaaatggagcaagcactt
gttgacttaagtacaaaagcaagaagtggcaagctctctgtttctgatatgtctggtgca
acctttactattaccaatggtggtgtgtatgggtcgctattgtctacccctataatcaac
cctcctcaatctggaatcttgggtatgcatgctatacagcagcgtcctgtggcagtagat
ggtaaggtagagataaggcctatgatgtatttggcgctatcatatgatcatagaatagtt
gacgggcaaggtgctgtgacgtttttggtaagagtgaagcagtacatagaagatcctaac
agattggctctaggaatttag

DBGET integrated database retrieval system