KEGG   Anaplasma phagocytophilum HZ: APH_1276Help
Entry
APH_1276          CDS       T00327                                 

Gene name
ispF
Definition
2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (EC:4.6.1.12)
Orthology
K01770  
2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC:4.6.1.12]
Organism
aph  Anaplasma phagocytophilum HZ
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aph00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    APH_1276 (ispF)
Enzymes [BR:aph01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.12  2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
     APH_1276 (ispF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1345210..1345683)
Genome map
AA seq 157 aa AA seqDB search
MGFDVHRFTESREEGQYIPICGIKVAHTQGIVAHSDGDVALHALTDALLGCMGEGSIGQH
FPNSDPQWKNASSSYFLLEAQKKAAAKSYAILNFDVTIVCEQPKIMPHVPKMKEFLSKLL
DVDVSQMNIKAVTTEKLGFLGRGEGIAAHAVLMCYRV
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgggttttgatgtacatagatttaccgagtcaagagaggaagggcagtacatacccata
tgtggaataaaggtagcgcatacacagggaatagttgcgcattcggatggggatgttgca
cttcatgcacttacagatgcattattaggctgcatgggagaggggagtatagggcagcat
tttcctaatagtgatcctcaatggaagaatgcaagctcatcttatttcttgttggaagca
caaaaaaaggctgccgcaaaatcttatgcgatactaaattttgacgtgactatagtgtgt
gagcaaccaaaaataatgccccatgtacctaaaatgaaagagtttctgtctaagctgtta
gatgttgatgtatcacaaatgaacattaaggcagtaacgacggaaaagcttgggtttttg
ggtcgcggtgaaggtattgcagcacatgccgtgttgatgtgttatagggtgtaa

DBGET integrated database retrieval system