KEGG   Anaplasma phagocytophilum JM: WSQ_02015Help
Entry
WSQ_02015         CDS       T02754                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
apha  Anaplasma phagocytophilum JM
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:apha03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
433839..434645
Genome map
AA seq 268 aa AA seqDB search
MPELPEVEVIARSLADKIIGQRIRDVEVKRRDLRVRIADDFEQLVTGREICSVYRVAKYL
VMQLDSGAKLVFHMGMSGRILYMHAPVPEKHDCVVFAMQHGYSLVFNDTRRFGLVTLLDG
EGYRSLLEKMGPDPFSEAFNADCLLNMHGKARIKSVLMNSAVVVGIGNIYASEILFTAAI
LPHREVSTLSREECCRIVESTREVLKLAIATGGSSIRDYRTPTGDVGNFSKHFRVYGRKG
EKCYTCGGEIQVEKQGGRSTFFCRHCQK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgccagaactaccagaagttgaggtgattgcaaggtctcttgcggataaaataataggt
cagcgcatacgtgatgtcgaggtgaagagacgtgatctgcgggtccgtatagctgatgat
ttcgagcagttagtgaccggaagagaaatatgttccgtatatagggttgccaagtatttg
gtgatgcagctggattctggagcaaagcttgtgttccatatgggtatgagtggcagaatc
ctatatatgcacgctcctgttccggagaagcatgattgtgtggtttttgctatgcagcat
ggctatagtcttgtgttcaatgatacacgcagatttggactagttacactgctggatggg
gaaggttacagatctttgctggaaaagatgggtcctgatccgttttcggaagccttcaat
gcagattgtttgctgaatatgcatgggaaagctcgtataaagtctgtcttaatgaatagt
gctgttgttgtaggaataggcaacatatatgcatcggagatactgttcactgctgctata
ttgccacacagggaagttagcactctttccagggaggagtgctgtagaattgtggagtct
acacgagaagtactcaagcttgctatagcaactggggggtcgtcaattcgcgactaccgt
acacctacaggtgacgttggtaatttttcgaagcactttagggtttatggcagaaaaggc
gaaaagtgctatacatgtggaggtgagatacaagtagaaaagcaaggagggagaagtacg
tttttttgtaggcactgtcagaaatga

DBGET integrated database retrieval system