KEGG   Anaplasma phagocytophilum JM: WSQ_02665Help
Entry
WSQ_02665         CDS       T02754                                 

Definition
NAD-glutamate dehydrogenase
Orthology
K15371  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
apha  Anaplasma phagocytophilum JM
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apha00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    WSQ_02665
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    WSQ_02665
   00330 Arginine and proline metabolism
    WSQ_02665
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    WSQ_02665
Enzymes [BR:apha01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     WSQ_02665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(585173..590059)
Genome map
AA seq 1628 aa AA seqDB search
MTAVRYDILSFVFYKSSVIKYTLKMHTTGDSSSSFDGHVVPSVLEALSRKSPQNIKYELL
KSFIEKFYNFSYSTDMELSAEFLLHMAEDLYQFINQRKPGESLVRVFDVARPNFPDESLT
IVETANDNLPFIVDSVMIAIKKHDLPIYHYTNSVLHIKRDDSGIVDVDILPSDSCAENGT
CESVAYFVVGKTTKDLQEKLKADVEKALYSVTCCVNDWKPMLDRVSDLLHDFEKDLSCSE
ICHFLKWMSSDNFVFLGFEEYVKSPSSSEDLVLLIERSLGLARIESHRESTKGSAYGRVH
LYVAQSNLVSNVHRHEYMMCVGIKTFNTSGDVIDVIKESCFYGFFTSAVAFQSVLDIPII
RRKVEYAEARSGFMRYGHNGKALFTIIQKFSREELLRASEEELFQISMGILSLSGNPKVK
LFTLRDTVNGFIVCIIFIPKSVASTELADRIALVLEGTLMGEVVGKYYNMYNESDLVRLQ
FTVKVAADAECLLSERDIEKLVVETTKRWEDRLAEVIMEKMGSKFLEYVTAFPKGYQEYF
APRSACHDILKIHKVLESGIGEVDLYLLDNDSQYQLKIYVPLESDLRLSKVLNVVKKMGA
KMSLHYGYDVNVHGQCMRLHHFVLSNTHRSLDHHRVKSQFETVLKQVFCKKTENDYFNSL
VILANLQWKEVLLIRALSRYLKQISFNYSQSYIQKVVRKYPDMINLFVKLFEARFDPKLS
EGREEKVASVRKSIEDLFAQVSDVVHDYVLKSMYMLIMAILRTSYYQGDKPYLSIKIDSC
AVPDMPLPRPFREIYVYSNEFEGIHLRGGRVARGGLRWSDRSEDFRTEILGLMKAQMTKN
SVIVPVGSKGGFILKGDSKKVSSVEYAVECYKNFLRGILDITDNIVDGQCVTADGIVRYD
DDDSYLVVAADKGTASFSDYANEVSAEYNFWLGDAFASGGSVGFDHKKIGITAKGAWVAA
QRHFWVMGRDIQRSTFTVIGIGDMSGDVFGNGMLMSDKICLLGAFNHKHIFVDPTPDPER
SFVERKRLFNTPGSSWQDYDAALISKGGGVFCRSSKSISLTKEMRQCFGIEDRESSISPN
CLIKHMLKAPVDMIWNGGIGTYVKSSKENNAVVGDKANDSLRIDGKEVRASMIVEGGNLG
CTQLGRVEYAEAGGQINTDFVDNSGGVICSDFEVNLKICMEMAVKDNFISLDERNKILDE
MLHDVLGIILTRHNTLETRALMLECMQAPKRVEQHHRIMQYLEKIGMLDRAIEFMPSDEE
IQKMISESKGFSTPQIAVLIAYTRMFIKGEIIKSGLLLRSGLEHVYESRYLLTYFPESMR
DRFAQYIRKHKLKHEILATCISNDIVNRMGCVFASHIESMGISIDMIVRIYVIIARVYNL
HDIWSELDRVDGAIGVDDYVRIVRKVQKFVGQATFWLFRHMHKFSDIEKRLDSLSEKTLL
LESQLTNVLCDEFLDAYRSAHEDLPKTDINPKVAQRIAGLEFSIFGMDIIDLSENSGVDL
ATVGRIYFKLRSVLSFSRIRDLATQMDSVSPYWQRIAIRNLLDDLSDYQSIIAKNIIKHM
IPKQSDMQESVDTVAQESVAAWCEQHRNQLDGYYRFLEDINSAQLDLSKLVLIIRSLSVF
TLGKDCDA
NT seq 4887 nt NT seq  +upstreamnt  +downstreamnt
ttgacagccgtaagatatgatatcctctcgtttgttttctacaagtcttctgttattaaa
tatacgttaaagatgcacactaccggagacagttcttctagttttgacgggcatgtggtt
ccctctgtactagaagctttgagtcgtaaatcgcctcaaaatataaaatatgagctgctg
aagagctttatagaaaagttttataacttttcgtacagcacagatatggaattgagtgct
gagtttcttctacacatggcagaggatttataccaatttataaaccaaagaaagccaggg
gaaagcttagtaagggtgtttgacgttgcaaggccaaacttccctgatgagtctcttaca
attgttgaaacggccaatgataatctgccgtttatagtggattcagtgatgatcgccatt
aaaaagcacgatcttcctatatatcactataccaactctgtgcttcatataaagcgagat
gatagcggaatagttgatgtggatatactaccgtctgactcttgtgcagaaaatggaact
tgtgagtctgtagcatactttgtggtaggcaagaccactaaagatttgcaagaaaagtta
aaggctgatgtggaaaaagccctttattcagtcacctgctgcgtaaatgattggaagcct
atgctcgatcgagtcagcgacttattgcatgactttgagaaagatctgagttgtagtgaa
atctgccattttttgaaatggatgtcctctgataacttcgtattcttgggatttgaggaa
tatgttaagtcaccatcttcaagtgaagatctggttttgctaatagagcgtagtctaggc
ctggctaggatagaaagccatcgggagtccacaaagggctctgcttatgggcgcgtgcac
ttatatgtagcacagtcaaaccttgtgtctaatgtgcataggcacgaatatatgatgtgc
gtgggtataaaaacatttaatacctcaggagatgtaattgatgtaattaaagaaagctgc
ttttacggtttcttcacctctgcggtggcctttcagagcgttcttgatatacctattatt
cggcgcaaagtggaatacgcagaagcgcggtctgggtttatgagatacgggcacaatggt
aaggccctttttactataatccagaagttttcaagagaagagctattgcgcgcttctgaa
gaggagctctttcaaatttcgatgggtattctttccttatcaggtaaccctaaggtcaaa
ttgttcacgctaagggatactgtaaacggatttatagtatgtattatctttattcctaag
agtgtagctagcactgaactcgctgatagaatagctctggttctagaaggaactttgatg
ggagaagtcgttggaaagtactataacatgtacaacgagtctgatcttgtgaggttacag
ttcactgttaaagttgctgctgatgctgagtgtttgctctccgaaagggatatagaaaaa
cttgtagtagagacaacaaagcgctgggaagataggcttgcagaagtcatcatggagaag
atgggctctaaattcttggagtatgtcactgcttttccaaagggttatcaggaatacttt
gctcctaggagcgcatgtcatgatatcctaaaaatccataaagttctggagagtggtatt
ggagaagtggatctatatctgcttgataatgacagtcaatatcaacttaagatatacgta
cctttggaaagtgatttacggctgtccaaggtgctcaatgtggtgaagaaaatgggcgca
aagatgtctcttcactatggctatgatgttaatgttcatggtcagtgcatgcggctgcat
cactttgtgttatcaaatactcatagatcattggatcatcacagggttaagagccaattt
gagacagtgctcaagcaagtattctgcaagaaaacagagaatgactactttaacagttta
gtaattttggcaaatctccagtggaaagaggttttgctcattagggcactcagcagatac
ttaaagcaaatatcgtttaattacagtcagtcgtacatacagaaggtggtgcgcaagtac
cctgacatgattaacctgtttgtgaagctgtttgaggctaggtttgatccaaagttatct
gaaggacgcgaagagaaagtggcgtcggttcgcaagtctatagaagatttgtttgctcag
gtttctgacgttgtacacgattatgtgctaaagagcatgtacatgctcataatggccata
ttgcgtactagttactatcagggtgataagccatatttatctatcaagatagactcctgt
gcggttcctgatatgccgttaccgcgcccgttccgtgaaatatatgtctattcgaatgag
tttgaaggcatacacttacgtggtggtagagttgctaggggtggcttgcgctggtcagac
aggtctgaagattttcgtactgaaatattaggccttatgaaggcgcagatgacgaaaaat
tctgttatcgtgcctgtaggttcaaagggtggatttattcttaagggtgattcgaaaaag
gtttcatctgtggaatatgctgtagagtgttataagaatttcttgcgcggtattctggat
attacagacaatatagtagatggccagtgcgttactgctgatggtattgtgcggtacgat
gacgatgattcataccttgttgttgctgcagacaagggtactgcttctttctctgattac
gcgaatgaggtgtccgcagagtataacttttggttaggtgatgcttttgcatcgggaggc
tctgtaggttttgatcacaagaagattggtataacagcaaaaggagcgtgggtagcggca
caaaggcacttttgggttatgggtagagatatccagaggagtacttttaccgttattggt
attggtgatatgtctggtgacgttttcggaaatgggatgctcatgtctgacaaaatttgt
ctacttggagcgtttaatcacaagcatatctttgtggatcctacaccagatcctgagagg
agttttgttgagagaaaaaggctatttaacactcctggatcatcgtggcaggattatgat
gctgctctaatttccaaaggtggaggtgttttctgtcgatcttctaaatctatttccctg
accaaggaaatgaggcaatgttttggaatagaagaccgggagagtagtatatcgccaaat
tgtctcattaagcatatgcttaaggcccctgtagatatgatatggaacggtggtatagga
acctacgttaaatcttcgaaagaaaacaatgcggttgttggtgacaaggcaaatgatagc
ctacgcattgatggaaaagaagtaagagcatccatgatagtagaaggtggaaatcttggg
tgtactcagctgggtcgtgttgagtatgcagaagctggggggcaaatcaatactgacttt
gttgacaattctggaggggtgatatgttcggattttgaagtcaatctgaagatatgcatg
gaaatggctgtcaaagataattttatatctcttgacgagaggaataaaatactagacgag
atgttgcatgacgtgcttggcattattttgacacgccataatacgcttgaaacccgagcg
ctgatgctggaatgtatgcaggcacctaagcgtgttgagcaacatcatagaatcatgcag
tatctagaaaaaattggaatgcttgacagagctatagagtttatgccaagcgacgaagag
attcagaagatgatttccgaatctaaaggcttcagtacgcctcagatagctgtgctcatt
gcttatactaggatgtttattaagggtgagattataaagtctggcttattacttcgcagt
ggcttagaacatgtgtatgagtcgcgatacttgctgacatatttcccagagagtatgagg
gatcgcttcgctcagtacatacggaagcataagttgaagcacgaaattcttgctacttgt
atatctaacgatatcgtgaacaggatgggttgtgtgtttgctagtcatatcgagagcatg
ggtatatccatagatatgatagtgaggatatacgttattattgctcgagtatataatctc
catgacatatggagcgaattggacagggtcgatggagctattggtgtagacgactatgtg
aggatagtccgcaaagttcagaagtttgtagggcaggctactttttggctcttcaggcat
atgcacaagttttctgatatagaaaagaggctagatagtctttcggagaagaccttatta
ttggagagtcagcttacaaatgtactttgcgacgagtttttagatgcgtatcgttctgcg
catgaggatttacctaagacggacatcaatccaaaggttgcgcaacggattgcggggctt
gagttctcaatttttggtatggacatcattgacctttcggagaattctggcgtagatctt
gcaactgttggacggatatattttaaactaaggtcagttctaagctttagcagaatacgc
gatttggcgacacaaatggattctgtatctccgtactggcagcgtattgctattagaaac
ttgttggatgatttgagtgattatcagtcgataattgctaagaacataatcaagcacatg
ataccgaaacagtctgacatgcaggaatctgtagatacggttgcgcaggagtctgtcgct
gcatggtgtgagcaacataggaatcagcttgacgggtactataggtttcttgaagacata
aactcagctcagcttgatcttagcaaacttgtactgattatcaggtctctgagtgtattt
actttaggtaaagactgcgatgcttaa

DBGET integrated database retrieval system