KEGG   Anaplasma phagocytophilum JM: WSQ_03985Help
Entry
WSQ_03985         CDS       T02754                                 

Gene name
sucA
Definition
(GenBank) MFS transporter
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
apha  Anaplasma phagocytophilum JM
Pathway
apha00020  Citrate cycle (TCA cycle)
apha00310  Lysine degradation
apha01100  Metabolic pathways
apha01110  Biosynthesis of secondary metabolites
apha01120  Microbial metabolism in diverse environments
apha01130  Biosynthesis of antibiotics
apha01200  Carbon metabolism
Module
apha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
apha_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apha00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WSQ_03985 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    WSQ_03985 (sucA)
   00380 Tryptophan metabolism
    WSQ_03985 (sucA)
Enzymes [BR:apha01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     WSQ_03985 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N PFOR_II
Motif
Other DBs
NCBI-ProteinID: AGR80180
UniProt: S5Q216
Position
complement(924715..927432)
Genome map
AA seq 905 aa AA seqDB search
MSNSSFRRDGCLYGDNALFVEEVYEGYEKCANALPDGWGELFTRIEEGKPEHSDRGRTDY
EACSSGTSVSPKVWGLIDFFRSHGHIAADLDPLGLTERVGLGHEEYLSSIDPNKDGSLWQ
KSGFSLDRLLEKLKKIYCGKIGFEFMYIRSNEERTWLQNKIENMRLECAGKEKRELLFHL
QETELFEQFLHVKYPGYKRFSVEGGDVLIVALEEIISLSPSLGVQEIVIGMSHRGRLSVL
TKVMKKPYVAMLHEFSGGMAYPSELNVTGDVKYHLGYSSDREVQGEVIHLSLAYNPSHLE
SVNPVVMGRVKGKIDSGLSVLGVLVHGDAAFIGQGVVAEGLNIGGVEGYTTGGIVHIVVN
NQVGFTTSPNSARTSLYCSDVARIIDAPVFHVNGDDPEAVVAVTKLAMEYRDKFKKDVVI
DVVCYRRYGHNEGDEPMFTQPLMYKCIAQHRTVAGSYGDKLVAEGVVSTQEIEEFRKKFR
VELDKAHAAVSAYKPMKADWFEGCWKGLRYAVPGCFDDYVSDTGVAGKRLLALMEAMCSI
PEGISLDKKVSRMLNARLNGVKSDSIDWGAGEALAFASLLAENKRVRLSGEDCGRGTFSH
RHARLIDQATGAEYLPLNNLGVEQAKFEVFNSPLSEFAVMGFEYGYSLDSPDVLVIWEAQ
FGDFANGAQVVIDQFIAAAETKWLRSSGLVLLLPHGYEGQGPEHSSARIERYLQLCAEDN
MQVVNCTTPANYFHVLRRQLHRDFRKPLVIFTPKSLLRNRMAVSKLSCFEGRFQPVIGEV
MAHDHAQVKRVVISSGKVYYDLLEARGDRQDVVLLRLEQYYPFPEEILAKELAKYPSAEV
IWCQEEHFNMGGWDFVRPRIEKSMKLANLKGVVAYIGRAESASTAAGYARAHEEERKCFI
DEVFA
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaacagtagttttcgcagagatggctgcttatacggtgataatgctctttttgtt
gaagaggtatacgaagggtatgaaaagtgtgccaatgctcttccagatggttggggtgag
ctttttacacgcatagaagaagggaaaccggagcattctgatcggggtagaacagattat
gaagcttgttcttctggcactagcgtttcgcctaaagtgtggggattgatagactttttt
agatcacatgggcatattgctgcggatttagacccgcttgggctgacggaaagagttgga
ctgggtcatgaggagtatctttcttcaatagatcctaataaggatgggtcgctttggcag
aagtcaggtttttcgttggatagacttttggaaaaactaaagaaaatttactgtggaaaa
atagggtttgagttcatgtacattcgttcgaatgaagaacgtacatggctgcaaaacaag
atagaaaatatgcgcctggagtgtgcaggaaaagagaagagagaactcttgttccatttg
caagaaacggaattatttgagcaattcttacacgttaaatacccgggatataagagattc
tctgtagaaggaggagatgttcttattgtagcattggaagagataatatcactatcacct
tctctgggtgtacaggagattgtgataggaatgtcacatcgtggtaggttgagtgtcctt
accaaagtgatgaagaagccatacgttgcgatgttacatgagttttctggtggtatggca
tatccgtctgagctaaatgttacgggagacgtaaagtaccatttggggtattcttctgat
agggaagtgcagggcgaagttattcatttatcactagcgtacaatccctctcacctagaa
tccgtgaatcctgtggttatgggaagggtaaaagggaagattgatagtgggttatccgta
ctcggcgtgctagtgcatggtgatgctgcttttatagggcaaggtgttgtggctgaaggc
ctcaatattggtggtgtggagggctacactactggtggtattgtccatattgttgttaat
aatcaggtggggttcacaactagtcctaacagtgccagaacttctctttattgttcggat
gttgctagaataatcgatgctcctgtttttcacgttaatggggatgatccagaagctgtg
gtagcagttacaaagcttgctatggagtatcgtgataagttcaagaaagacgttgtgata
gatgtggtgtgttatcgccgttatggccacaatgaaggtgatgagcctatgtttacgcag
ccgcttatgtataagtgcatagcgcagcataggactgtagcgggttcttacggtgataag
ctggttgcagaaggcgtggtatctactcaggaaatagaggagtttcgtaagaagttccgg
gtagaattggacaaagcgcatgctgcagtttctgcgtataagccgatgaaagctgactgg
ttcgaaggatgttggaaaggtttgagatatgcggttccagggtgctttgacgactacgtg
tcagatactggtgttgcaggaaagaggcttcttgctctgatggaagctatgtgttctatt
cccgaggggatatcgctggataagaaagtctccaggatgttgaatgcgagattaaacggt
gtaaagagcgatagcatagattggggagctggtgaggcattagcatttgcatccttgttg
gcggaaaacaagagggtgcgtctatctggtgaagactgcggtagggggactttctcgcac
cgccatgcaaggttgattgatcaagctacaggtgcggaatatttgcctttgaacaatctg
ggagttgagcaagcaaagtttgaagtattcaatagtccgttatctgagtttgctgttatg
ggatttgagtacggttatagcttggattctccggatgttcttgtgatatgggaagctcag
tttggtgattttgctaatggtgcgcaggtagtaatagatcagtttatagcggcggctgaa
accaagtggttgcgttctagtgggttggttttgttacttccccatgggtatgagggacaa
ggtccagagcacagctctgcgaggatagaaagatatcttcagctttgtgcggaagacaac
atgcaggttgttaactgtactacaccggctaactattttcacgtactccgtaggcagtta
cacagagatttcagaaagcctcttgtcattttcactccgaagtctttattgagaaatagg
atggctgtgtctaaattgtcctgttttgaaggtagatttcagccggtgataggtgaggtg
atggcccatgaccatgctcaggtaaagagggtggttatatctagtggaaaagtatactac
gatctccttgaagcaaggggtgataggcaagatgttgtactattgagattggagcaatat
tatccatttccggaagagattttggctaaagagcttgcgaagtatccttcagcagaggtg
atatggtgtcaggaagagcatttcaacatgggaggatgggattttgttcggcctcgtata
gaaaaatcgatgaagctagctaatttgaagggtgttgtggcttatattggtcgagctgag
tctgcgtccactgcggctggttacgcgcgcgctcatgaggaagagcgtaaatgtttcata
gatgaagtatttgcctag

DBGET integrated database retrieval system