KEGG   Anaplasma phagocytophilum JM: WSQ_03985Help
Entry
WSQ_03985         CDS       T02754                                 

Gene name
sucA
Definition
MFS transporter (EC:1.2.4.2)
Orthology
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
apha  Anaplasma phagocytophilum JM
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WSQ_03985 (sucA)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WSQ_03985 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    WSQ_03985 (sucA)
   00380 Tryptophan metabolism
    WSQ_03985 (sucA)
Enzymes [BR:apha01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     WSQ_03985 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(924715..927432)
Genome map
AA seq 905 aa AA seqDB search
MSNSSFRRDGCLYGDNALFVEEVYEGYEKCANALPDGWGELFTRIEEGKPEHSDRGRTDY
EACSSGTSVSPKVWGLIDFFRSHGHIAADLDPLGLTERVGLGHEEYLSSIDPNKDGSLWQ
KSGFSLDRLLEKLKKIYCGKIGFEFMYIRSNEERTWLQNKIENMRLECAGKEKRELLFHL
QETELFEQFLHVKYPGYKRFSVEGGDVLIVALEEIISLSPSLGVQEIVIGMSHRGRLSVL
TKVMKKPYVAMLHEFSGGMAYPSELNVTGDVKYHLGYSSDREVQGEVIHLSLAYNPSHLE
SVNPVVMGRVKGKIDSGLSVLGVLVHGDAAFIGQGVVAEGLNIGGVEGYTTGGIVHIVVN
NQVGFTTSPNSARTSLYCSDVARIIDAPVFHVNGDDPEAVVAVTKLAMEYRDKFKKDVVI
DVVCYRRYGHNEGDEPMFTQPLMYKCIAQHRTVAGSYGDKLVAEGVVSTQEIEEFRKKFR
VELDKAHAAVSAYKPMKADWFEGCWKGLRYAVPGCFDDYVSDTGVAGKRLLALMEAMCSI
PEGISLDKKVSRMLNARLNGVKSDSIDWGAGEALAFASLLAENKRVRLSGEDCGRGTFSH
RHARLIDQATGAEYLPLNNLGVEQAKFEVFNSPLSEFAVMGFEYGYSLDSPDVLVIWEAQ
FGDFANGAQVVIDQFIAAAETKWLRSSGLVLLLPHGYEGQGPEHSSARIERYLQLCAEDN
MQVVNCTTPANYFHVLRRQLHRDFRKPLVIFTPKSLLRNRMAVSKLSCFEGRFQPVIGEV
MAHDHAQVKRVVISSGKVYYDLLEARGDRQDVVLLRLEQYYPFPEEILAKELAKYPSAEV
IWCQEEHFNMGGWDFVRPRIEKSMKLANLKGVVAYIGRAESASTAAGYARAHEEERKCFI
DEVFA
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaacagtagttttcgcagagatggctgcttatacggtgataatgctctttttgtt
gaagaggtatacgaagggtatgaaaagtgtgccaatgctcttccagatggttggggtgag
ctttttacacgcatagaagaagggaaaccggagcattctgatcggggtagaacagattat
gaagcttgttcttctggcactagcgtttcgcctaaagtgtggggattgatagactttttt
agatcacatgggcatattgctgcggatttagacccgcttgggctgacggaaagagttgga
ctgggtcatgaggagtatctttcttcaatagatcctaataaggatgggtcgctttggcag
aagtcaggtttttcgttggatagacttttggaaaaactaaagaaaatttactgtggaaaa
atagggtttgagttcatgtacattcgttcgaatgaagaacgtacatggctgcaaaacaag
atagaaaatatgcgcctggagtgtgcaggaaaagagaagagagaactcttgttccatttg
caagaaacggaattatttgagcaattcttacacgttaaatacccgggatataagagattc
tctgtagaaggaggagatgttcttattgtagcattggaagagataatatcactatcacct
tctctgggtgtacaggagattgtgataggaatgtcacatcgtggtaggttgagtgtcctt
accaaagtgatgaagaagccatacgttgcgatgttacatgagttttctggtggtatggca
tatccgtctgagctaaatgttacgggagacgtaaagtaccatttggggtattcttctgat
agggaagtgcagggcgaagttattcatttatcactagcgtacaatccctctcacctagaa
tccgtgaatcctgtggttatgggaagggtaaaagggaagattgatagtgggttatccgta
ctcggcgtgctagtgcatggtgatgctgcttttatagggcaaggtgttgtggctgaaggc
ctcaatattggtggtgtggagggctacactactggtggtattgtccatattgttgttaat
aatcaggtggggttcacaactagtcctaacagtgccagaacttctctttattgttcggat
gttgctagaataatcgatgctcctgtttttcacgttaatggggatgatccagaagctgtg
gtagcagttacaaagcttgctatggagtatcgtgataagttcaagaaagacgttgtgata
gatgtggtgtgttatcgccgttatggccacaatgaaggtgatgagcctatgtttacgcag
ccgcttatgtataagtgcatagcgcagcataggactgtagcgggttcttacggtgataag
ctggttgcagaaggcgtggtatctactcaggaaatagaggagtttcgtaagaagttccgg
gtagaattggacaaagcgcatgctgcagtttctgcgtataagccgatgaaagctgactgg
ttcgaaggatgttggaaaggtttgagatatgcggttccagggtgctttgacgactacgtg
tcagatactggtgttgcaggaaagaggcttcttgctctgatggaagctatgtgttctatt
cccgaggggatatcgctggataagaaagtctccaggatgttgaatgcgagattaaacggt
gtaaagagcgatagcatagattggggagctggtgaggcattagcatttgcatccttgttg
gcggaaaacaagagggtgcgtctatctggtgaagactgcggtagggggactttctcgcac
cgccatgcaaggttgattgatcaagctacaggtgcggaatatttgcctttgaacaatctg
ggagttgagcaagcaaagtttgaagtattcaatagtccgttatctgagtttgctgttatg
ggatttgagtacggttatagcttggattctccggatgttcttgtgatatgggaagctcag
tttggtgattttgctaatggtgcgcaggtagtaatagatcagtttatagcggcggctgaa
accaagtggttgcgttctagtgggttggttttgttacttccccatgggtatgagggacaa
ggtccagagcacagctctgcgaggatagaaagatatcttcagctttgtgcggaagacaac
atgcaggttgttaactgtactacaccggctaactattttcacgtactccgtaggcagtta
cacagagatttcagaaagcctcttgtcattttcactccgaagtctttattgagaaatagg
atggctgtgtctaaattgtcctgttttgaaggtagatttcagccggtgataggtgaggtg
atggcccatgaccatgctcaggtaaagagggtggttatatctagtggaaaagtatactac
gatctccttgaagcaaggggtgataggcaagatgttgtactattgagattggagcaatat
tatccatttccggaagagattttggctaaagagcttgcgaagtatccttcagcagaggtg
atatggtgtcaggaagagcatttcaacatgggaggatgggattttgttcggcctcgtata
gaaaaatcgatgaagctagctaatttgaagggtgttgtggcttatattggtcgagctgag
tctgcgtccactgcggctggttacgcgcgcgctcatgaggaagagcgtaaatgtttcata
gatgaagtatttgcctag

DBGET integrated database retrieval system