KEGG   Acyrthosiphon pisum (pea aphid): 100144895Help
Entry
100144895         CDS       T01076                                 

Definition
(RefSeq) cytochrome c-like protein
  KO
K08738  cytochrome c
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api01100  Metabolic pathways
api04214  Apoptosis - fly
api04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:api00001]
 Cellular Processes
  Cell growth and death
   04214 Apoptosis - fly
    100144895
   04215 Apoptosis - multiple species
    100144895
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Cytochrome-c551
Motif
Other DBs
NCBI-GeneID: 100144895
NCBI-ProteinID: NP_001119631
APHIDBASE: ACYPI000041
UniProt: Q1ZZQ7
Position
Un
AA seq 104 aa AA seqDB search
MGDVDKGAKVFQTKCSQCHTVEAGGKHKVGPNLHGLFGRKTGQAAGYSYTDANKQKGITW
NETTLFEYLENPKKYIPGTKMVFAGIKKVEERNNVIAYLKKATA
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacgtagacaaaggagccaaagtattccaaactaaatgctctcaatgccacact
gttgaagcgggaggcaaacacaaagttggacccaacttgcacggtttattcggacgtaaa
accggtcaagctgctggttattcttatactgatgccaataaacaaaagggtatcacatgg
aatgaaaccacattattcgagtacttagaaaaccccaagaaatatatacctggcactaaa
atggtgtttgctggcattaagaaagtagaagagagaaacaacgttattgcttatttgaaa
aaagctaccgcgtaa

DBGET integrated database retrieval system