KEGG   Acyrthosiphon pisum (pea aphid): 100144895Help
Entry
100144895         CDS       T01076                                 

Definition
cytochrome c-like protein
Orthology
K08738  
cytochrome c
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100144895
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 104 aa AA seqDB search
MGDVDKGAKVFQTKCSQCHTVEAGGKHKVGPNLHGLFGRKTGQAAGYSYTDANKQKGITW
NETTLFEYLENPKKYIPGTKMVFAGIKKVEERNNVIAYLKKATA
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacgtagacaaaggagccaaagtattccaaactaaatgctctcaatgccacact
gttgaagcgggaggcaaacacaaagttggacccaacttgcacggtttattcggacgtaaa
accggtcaagctgctggttattcttatactgatgccaataaacaaaagggtatcacatgg
aatgaaaccacattattcgagtacttagaaaaccccaagaaatatatacctggcactaaa
atggtgtttgctggcattaagaaagtagaagagagaaacaacgttattgcttatttgaaa
aaagctaccgcgtaa

DBGET integrated database retrieval system