KEGG   Acyrthosiphon pisum (pea aphid): 100158782Help
Entry
100158782         CDS       T01076                                 

Definition
protein disulfide-isomerase TMX3
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100158782
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 430 aa AA seqDB search
MMISNILTTTLSVGFIVSVILLKDVRSSRVLELSDKFIEMKHDGHWFIMFYAPWCGHCKR
LEPIWRHVAQALHHSDIRVGKIDCTRYKRVVSEFGLSGYPTIMFFRDREGEFKFNSERST
EEMVHFAKRLARPPVQEVTDSKDIEMLKQTNKNFFMFIGKSVGHTWDLFYDLAKQYQAHS
YFYITPEITGKQHFVFGETPAVVVYKEEQHYSFNAEEWDMDFNTSLTQWINTERFDTFVK
VTRSNIHHMLETNKYLVLALVEENKIEKLPPQHSEFLQMVESVIVKNRERFHRNFQFGWI
GSPEFANSITSSDVTLPSLIIYNSSTRHHHFPEEKPHELTPESITLFLEAVRNQSVKAYG
GSGVFIQMYRMYYETKKSLVNIWVNNPAVASVLFGLPIGFLLLICYSTCCTDIMDASDDD
EDDVHHEKKE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgatgatctctaatatattaactacaactctttccgtgggttttattgtatctgttatt
ctactaaaagacgtacgttcatcaagagtattggaacttagtgataagttcattgaaatg
aaacacgatggacattggtttataatgttttatgctccgtggtgtggccattgtaagagg
ttagaacctatctggcgtcatgttgctcaagcattacaccactctgatataagagttggc
aaaatagattgtacaagatataaaagagtagtttcagagtttggattgtctgggtatcct
acaataatgttcttcagagatagagaaggtgaatttaaatttaatagtgagcgatctaca
gaagaaatggttcattttgcaaagcgattggctcgtcctcccgttcaagaggttactgat
agtaaagacattgaaatgctcaaacaaacaaataaaaacttctttatgtttattggaaaa
agtgttggccatacttgggacctcttttatgatttggcaaaacaatatcaagcacattct
tatttttatattacacctgaaataactggaaaacagcattttgtttttggagaaactcct
gcagttgtggtgtataaagaagaacaacactactctttcaatgctgaggaatgggatatg
gacttcaatacaagcttgacacaatggataaacacagaaagatttgatactttcgtaaaa
gtaactcgatcaaatattcaccatatgttggagaccaacaagtacttagtcttagcatta
gtggaagagaataaaattgaaaagttacctccgcaacattcagagtttcttcaaatggta
gaatcagttattgtgaagaatagagaacgttttcataggaactttcaatttggatggatt
ggttcaccagaattcgccaattctattacttcatcagatgtaaccctaccatcattaatc
atttacaattcatctactagacatcatcatttcccagaagaaaaaccacatgaactgaca
cctgaatcaattactttatttctagaagctgtaagaaatcagtcagtaaaggcatatgga
ggaagtggtgtatttatacagatgtacaggatgtattatgagacaaagaagtctttagta
aacatctgggttaacaatcctgcagttgctagtgttttatttggattacctatagggttc
ctactattaatatgctattctacgtgttgcacagacattatggatgctagtgatgatgat
gaagatgatgtacatcacgagaagaaagaataa

DBGET integrated database retrieval system