KEGG   Acyrthosiphon pisum (pea aphid): 100158903Help
Entry
100158903         CDS       T01076                                 

Definition
OTU domain-containing protein 5-B
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100158903
Peptidases [BR:api01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   100158903
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 394 aa AA seqDB search
MTVLSKKKAQALSEECEPSSSAHGHVLPLSTTQTHSQINTLDERIKSPQRWSVENIENVL
SSKQAKRRIHRSPHRNTRNSKGRDRDNRSSQSPGTCQCGATDLNGHCSSDKCGYNSEDEY
GEIPKQFNDMEWAEQDRIFEKKLKKCDLILKQMKDDGACLFRAVSDQLYGDQDMHDIVRK
QCMDYVSSNKDYYMQYVTEDFNTYIARKRLDRTHGNHVEIHAMSELYNRPIEVYCYEIEP
INIFNRANTSESSNPPIRLSYQRGSHYNSIVDPHKATIGIGLGLPSFSPGSADNKLLTDA
VRQSEDYMLEQTMLEDKLRATDWEATNDTIEEQIARESYLQFLKDNEKRNKNDKESSATS
TATSASIVKSYQSRTSPPRYSVGPKTPPHLSPSQ
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacggttttatcgaaaaaaaaggctcaggccctatcggaagaatgtgaaccttcatcg
agtgcacacggccatgtcttacctctttcaacaacccaaacacattctcagataaataca
ttagatgaacgaattaagtctccacaaagatggtctgtagaaaatattgaaaatgtctta
agttcaaaacaagcaaaacgcaggattcaccgtagtcctcacagaaatacaagaaatagt
aaaggacgtgatagagacaatagatcgtctcaaagtcctggtacttgccagtgtggagcc
actgacttaaatggtcactgtagttcagataaatgtggatataatagtgaggatgaatac
ggcgaaattccaaagcaattcaatgacatggaatgggctgagcaagatcgtatctttgaa
aaaaagttgaaaaaatgtgatttgattttaaaacaaatgaaagatgatggtgcatgtctg
tttagagctgtatcagatcaattatatggcgaccaagatatgcacgatatagttcgtaaa
caatgcatggattatgtctcaagcaataaagattactatatgcagtatgttactgaagat
ttcaatacatatattgctcgtaaaagactagaccgaactcatggaaaccatgtagaaata
catgctatgtctgagttatataaccgtccaattgaagtttattgttatgaaattgaacca
ataaatattttcaatagagctaatacatcagagtcctctaatccaccaataagattatct
tatcaaagaggaagtcattataatagtattgtagatccacataaagcaacaattggtata
ggattaggattaccaagtttttcacctggttcagccgataataaattgttaactgatgct
gttcgtcaaagcgaagattacatgttagaacagacaatgttagaagataaactcagagct
acagattgggaagccacaaatgatacaatagaagaacaaatagcacgtgaaagctattta
caatttttaaaagataatgaaaaacgaaataaaaacgataaagagtcttcagctacgtca
actgccacttctgcatctattgtcaaatcatatcaatctcgaacttcgcctccaagatat
tcagttggacctaaaaccccacctcacttatctccttcacag

DBGET integrated database retrieval system