KEGG   Acyrthosiphon pisum (pea aphid): 100158926Help
Entry
100158926         CDS       T01076                                 

Gene name
USP7
Definition
ubiquitin specific peptidase 7
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:api00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100158926 (USP7)
Enzymes [BR:api01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100158926 (USP7)
Peptidases [BR:api01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100158926 (USP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1105 aa AA seqDB search
MNHMVERDSQNDVPEEMDITEALTNEVSPLMLGNAQEMPIINDLVVPDSIPIISTDVEME
EDNARPEATFRFEIENFSKSKEQRLSPPCYVRDLPWKIMIMHRVSQDNRSAKPAQPSVGF
FLQCNGDSENTSWSVNASAELRVISQKEGISNVERKIQHLFYPKENDWGFSFFMSWEDIT
DEAKGFIKNDTVIFEVSVTADAPHGVSWDSKKHTGYVGLKNQGATCYMNSLLQALYFTNQ
LRKAVYKMPTESDDSNKSVALALQRVFHELQFYDKPVGTKKLTKSFGWETLDSFMQHDVQ
EFLRVLLDKLENKMKGTCVEGTIPKLFEGKMISYINCKNVDYSSKRTETFYDIQLNIKGK
KNIYESFKDYIQVEILDGDNRYDAGEYGLQDAEKGVIFASFPPVFYLHLMRFQYDPVTDS
SVKFNDRFEFYDKINLDQYLKVKEDTPADYILHAVLVHSGDNHGGHYVVFINPKGDGKWC
KFDDDVVSRCPKEEAIEHNFGGNDGDENMMPIKQCTNAYMLVYIRDSELKNVLQEVTIND
IPKELVERLQDEKRIETIRRKERNDLHIYTNIQVFLEDCFDSYLGIDLFDLEQPTFRTVK
VKKNNNLEEVHQLLAETFKYQSNQIRIWPLIASKHESLRPMYLDGEANALKTIQDLHDSS
STTWNIWLELVEPGVSSLMPFDRSNQSLIFFKLFIPEERLLVYCGYHFASFETPLDSLIN
IMNKRAGFEEDTKLAIYKETNKNEIEKITKLDDPICEIIQTSTYGEILIYQKEELVKTYP
SVTDHFKNICSQVYITFCDKLIPNDPGFTLGLPMWMLYHDMLQAVAERVSVDQRKLQIYF
SVNGQKECPGEPIKNSYNGPIRDLITNNSYGKRYPKKFFYQEMHMPVDELESKKPVKIIW
CGPKLKDEREIILYLNKNDTSCTHFYEVLHGSVELSPEGSGKFRTLEIMSAKISKWFNPG
VKMPDIATVFPAKYYRVEEVPTDEMELSENELLVPVNHFSKEVYSTFGTPFLIKIIHEET
LADVKERIVNKTGIPDKELEKYKFAICQGVRANFIPDTHIMSLQDFKAPPTSQGQGQRPW
LGMEHPNKTKRTRLNYLEKAIKIYN
NT seq 3318 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacatggtcgaacgggacagtcagaatgacgttccggaagaaatggacatcact
gaagcgctaaccaatgaagtttcacctttgatgttgggcaacgctcaggagatgccaatc
attaatgatcttgtagtacctgattcaattcccattatttcaactgatgtagagatggaa
gaagacaatgcacgaccagaagcaacttttagatttgaaattgaaaattttagtaagtct
aaggaacaaagactatcacctccttgttatgttcgagatcttccatggaaaataatgata
atgcatagagtaagccaagacaatcgatctgctaaacctgctcagccttctgttggtttt
tttcttcaatgtaatggtgattcagaaaatacttcctggagcgttaatgcaagtgctgaa
cttcgtgttatatcgcaaaaagagggcatcagtaatgttgaacgtaaaattcaacatctg
ttttacccaaaagagaatgactggggatttagttttttcatgtcttgggaagatataacg
gacgaagccaaaggatttattaaaaatgataccgttatatttgaagtatctgtaacagct
gatgcaccgcatggtgtaagttgggattcaaaaaaacatactggatatgtaggtctgaaa
aaccaaggtgccacatgctatatgaactcacttttacaagcgttatatttcactaatcaa
ctacgtaaggctgtatataaaatgcctactgaaagtgatgatagcaataaaagtgttgca
ttagcattacaaagagtattccatgagcttcaattttatgataaacctgttggaacaaaa
aaactaactaaaagttttggatgggaaacacttgattcatttatgcaacatgatgttcaa
gaatttttaagagttttgcttgataaattggaaaataaaatgaaaggcacatgtgttgaa
ggcactatacctaagttattcgagggtaaaatgatttcttacataaattgtaaaaatgtg
gattactcttcaaagcgaactgaaaccttttatgacattcagctcaatataaaaggaaaa
aaaaacatttatgagtcgttcaaagattatatacaagttgagatactagatggtgataac
agatatgatgctggagagtatggtttacaagatgctgaaaaaggagttatatttgcatca
ttcccgcctgttttttatttacaccttatgcgatttcaatatgatccagttacagatagt
tctgttaaattcaatgatagatttgagttttatgataaaattaatttggatcagtattta
aaagtaaaagaagataccccagctgattacatattgcatgcagttcttgttcatagtggg
gataatcatggtggacattatgttgttttcattaatcctaaaggcgacggaaagtggtgt
aaatttgatgatgatgttgtctcaagatgccctaaagaagaagccatagaacataatttt
ggtggtaatgatggagatgagaatatgatgccgataaagcaatgtactaatgcatacatg
ttagtttatattcgtgattctgaattaaaaaatgtgctacaggaagttacaattaatgat
ataccaaaagagttggtagaacgattgcaagatgaaaaacgtattgaaacaataagaaga
aaagaacgaaatgatttacatatatataccaatatacaagtttttttggaagattgtttt
gatagttatttgggaattgacttgtttgatttggagcaacctaccttccgaacagtcaaa
gtaaaaaaaaacaataatttagaagaagtccatcaattattagctgaaacttttaaatat
caatcaaatcaaataagaatttggccacttattgccagtaaacatgaatctctgagacct
atgtatcttgatggagaagcgaatgctttaaaaactattcaagacttacatgatagttca
tcaactacatggaatatttggttagagttagtagagccaggtgttagttctctaatgcct
tttgatagaagtaatcagtccctgattttcttcaaattgtttataccagaagagaggctg
ttagtttattgtggttaccattttgcaagctttgaaacaccattagattctctaattaac
atcatgaataaacgagctggttttgaggaagataccaaacttgcaatttataaagaaact
aacaaaaatgaaatagaaaagataaccaaacttgatgatccaatttgtgaaataattcag
acttcaacttatggagagatattaatctaccaaaaagaagaacttgtgaaaacttatcct
tctgttactgatcattttaaaaatatttgttctcaagtgtatataacattttgtgataaa
cttattcctaacgatcctggatttaccttgggattacctatgtggatgttgtaccacgat
atgttacaagcagttgctgaaagagtatctgttgatcaacgcaaattgcagatttatttt
agtgttaatggtcaaaaggaatgccctggtgaaccgattaaaaactcttataatggacca
attcgagacctcataacaaataacagctatggtaaacgatatcctaagaaatttttttat
caggaaatgcacatgccagttgatgagttagaaagcaagaagcctgttaaaattatttgg
tgtggtcccaaattaaaagacgaaagagaaataattttgtatcttaataagaatgatacc
tcatgtactcatttttatgaagtattacatggcagtgtagaattgtcacctgaaggatct
ggaaaattcagaacgctagaaattatgtcagctaaaataagtaaatggttcaatcctgga
gtgaaaatgcccgacattgcaacagttttcccagcaaaatactatagagtagaagaagta
ccaacagatgaaatggaactcagtgaaaatgaattattagttcctgttaaccatttttca
aaagaagtatactccacttttggtactccttttcttattaaaattattcatgaagagact
ttagcagatgtaaaagaacgaattgttaacaagactggtattccagacaaagagctggaa
aaatataaatttgcaatttgccaaggagtcagagcaaattttattcctgatactcatatt
atgagcttacaagattttaaagcacctcctacctctcaaggacaaggccaacgaccatgg
ttgggcatggaacatccaaataagactaaacgcacacggttaaattatttagaaaaagct
ataaaaatctataactga

DBGET integrated database retrieval system