KEGG   Acyrthosiphon pisum (pea aphid): 100158931Help
Entry
100158931         CDS       T01076                                 

Definition
MAGUK p55 subfamily member 5-like
Orthology
K06091  
MAGUK p55 subfamily member 5
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Hippo signaling pathway - fly
Class
Environmental Information Processing; Signal transduction; Hippo signaling pathway -fly [PATH:api04391]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1016 aa AA seqDB search
MDLSGYVLILKETEDNKAKLLGSKVDRADFETGDEIFAINGQQIAEMTRDDLLSYLYQCI
VTRTICMNLKPRVKKVVTTSIDSAGSDLGQVHDAFFIGIEDEAKERLERLAASKRITPVD
ITKLAHQLMRQLHPTTELNDFLDNKVHSGRVGSSCPPDNGNKLTEQADPKLSRRPSSPFN
NGHTEVLICKDVTDSNNRLKAVDETNETQNWSRRRSGGGLVRVGSEVGTLEKKRAVEDVT
GETLDMMVMMSALDNGPHREMAVDVPDSFIARNKTPPRYPPPSRANRTPGTQQNGSAVSE
RHAAPPPPPPRSDVIKQQLHQASINNNTIVTISSTEPTKEQLESIKKYQDALRKRKEEED
RVAQQNEFLNRSMRGSKKLRELEHEPPETGIVNDGFSSEQDEDNNRTTIGAVDDAEEESQ
DPYEPIYRVVGYGELIAALQRVHLQLKKNGIYINGKSDPDVAVIQCLLLNPEFVRVLSVH
NKVQQLWPPTTTKRPVTPEAQNLVRDCLENIHNSNLPEASELAKLLSQYEIEGVLWAHDT
IAQDVLPQDDEATTEVTVTLPVDDSSMYNTDQHPPNITIINIEKTNEPLGATVRNDGDAV
IIGRIVRGGAAEKSGLLHEGDEVLEVNGVEMRGKSINDVCDILSVMTGPLTFMIVPSANR
VTYQNINGNRENFIMHMKAHFDYDPEDDGYIPCRELGISFQKGEILHVISQEDANWWQAF
REGEEDQTLAGLIPSKSFQHQREALKQTITGEKPDKNKPKKQKNTLLCGKKNLKKRKKKS
LYQDGGYPIYSSNSDEYEAEEILTYEEVALYYPRANHKRPIVLIGPPNIGRHELRQRLME
DRDRFAAAIPHTSRAKKDGEIDGQDYHFITRVQFESDILSRKFVEHGEYEKAYYGTSLDA
IRSVVNFSKICVLNLHPQSLKILRSSDLKPFVVFVAPPSLEKLRQKRLKNGEPYKEEELK
EIIEKAREMEDKFGHYFDMIIINNDTERAYHQLLNEINSLEREPQWVPATWVKTAS
NT seq 3051 nt NT seq  +upstreamnt  +downstreamnt
atggatctcagtggatacgtactaatactcaaagaaactgaagataataaagccaagctt
ttaggctcaaaagtcgaccgcgcggatttcgaaacaggtgatgaaatattcgcaattaat
ggacagcaaattgcagaaatgactcgcgacgatttattatcttatctctaccagtgtatt
gttacaagaaccatatgcatgaatttaaaacctcgagtaaaaaaagtcgtgacgaccagc
atagactcggcgggttccgatctaggtcaagttcatgatgccttcttcatcggaattgaa
gatgaagccaaagaacggttggaacggctggcggctagcaaacgtatcacaccagttgac
attactaaattggctcatcagttgatgcgtcaattgcacccaacaaccgaactcaacgat
tttttagacaataaggtacacagtggccgtgtcggttcttcatgcccaccggacaacgga
aataaattaaccgaacaagccgaccccaaattatctaggagacctagttcaccattcaat
aatggtcataccgaggttcttatctgcaaagatgtcaccgatagtaataatagactgaag
gctgtcgacgagaccaacgaaactcaaaactggtctcgtcgtagaagtggcgggggattg
gttcgcgtgggtagtgaagtcggtacgctggaaaaaaagcgagctgtcgaagacgtgaca
ggcgaaacgctggacatgatggtcatgatgagcgcgctggacaacgggccacaccgcgag
atggccgtcgacgttccggactcgtttatcgcccgcaacaagacgccgccgaggtaccca
ccgccgtccagggcgaaccgcacacccggaacccaacaaaacggttctgcggtatcagag
agacacgcggctccgccacctccaccgccccggtccgacgtaatcaaacagcagcttcat
caggccagcatcaacaacaacactatcgttaccatatcgtccaccgagcccactaaggag
cagttggagagcatcaaaaaataccaggacgcgctgcggaagcgaaaagaagaagaggac
agggtcgctcaacaaaacgaatttctcaatcggtcgatgagagggtcgaaaaaacttcgg
gagctcgaacacgaaccgccggaaacgggaatcgtcaacgacgggttttcgtcggaacag
gacgaggacaacaaccgcaccaccatcggtgcggtggacgacgccgaagaagaatcgcag
gatccgtacgagccgatatacagggttgtggggtacggtgaactgatagccgcgctccag
agggtacacttgcagctgaaaaagaacggaatctacatcaatggcaagtcggatccagac
gtggctgtgatccaatgcctattgctgaacccggaattcgtccgcgtgctgtccgtgcac
aacaaggtgcagcagttgtggcctcccaccacgaccaagaggccggtgactccggaagcg
caaaatttggtccgagactgtctcgagaacattcataacagtaacttgcccgaagcatcg
gaactcgctaaactattgtcccagtacgaaatcgaaggcgtgctctgggctcacgacact
atagctcaggacgtgttgccgcaagacgacgaggctactaccgaggtaacggtcacgtta
cccgtggacgattcatcgatgtacaacaccgaccaacatccccccaacatcacaataatc
aatatcgaaaaaaccaatgaaccattgggtgccactgttcgaaacgacggtgatgcggtg
atcatcggccgaatagtcagaggtggcgcagccgaaaaaagtggactgctccacgagggc
gatgaagtgttggaggtgaatggtgtagaaatgcgcggcaagtccataaatgatgtctgt
gatatcctgtccgtgatgactggacctctaacgttcatgattgtaccgagtgctaatcgg
gttacataccagaacataaacgggaaccgagaaaatttcatcatgcatatgaaagctcac
ttcgattacgaccccgaagacgatggttacatcccatgcagagaactgggtattagtttc
caaaagggtgagatcttacatgttatatctcaggaagacgccaactggtggcaggcgttc
agagagggcgaagaagatcaaacactggccggtcttatacccagcaaatcttttcaacat
cagcgtgaagcattaaaacaaaccataaccggcgagaagcctgacaaaaataaacccaaa
aaacaaaaaaatacgcttctctgtggcaaaaagaacctgaaaaaaaggaaaaagaagtca
ctatatcaagacggaggttaccctatttattcgtccaactctgatgaatatgaagccgaa
gagatactgacatatgaagaagtggccttgtattatccacgggcaaaccataaaaggcca
attgtgttgattggcccacctaacattggccgacacgagctcaggcaaagattaatggaa
gaccgtgataggtttgcagctgctattccccatactagccgagcgaaaaaagacggtgaa
atagatggtcaagattatcacttcatcaccagggttcagtttgaatcggacattctgtcg
aggaagtttgttgaacacggtgaatacgagaaagcttattacggcacgtcgctggacgcc
atccggtcggtggttaacttcagtaagatatgcgtgttaaacctacacccacagtcgttg
aaaattctccggagttccgatttgaagcccttcgtcgtgtttgtagctccaccgtccttg
gaaaaactacgtcaaaagagactaaagaacggcgaaccttacaaagaggaagagctgaaa
gagataattgaaaaggcgagagaaatggaagacaagttcggccattacttcgacatgatc
atcatcaataacgataccgagagagcgtatcaccagttattaaacgaaataaatagtcta
gaaagagaaccgcaatgggtgccagctacttgggtaaaaaccgcgtcatag

DBGET integrated database retrieval system