KEGG   Acyrthosiphon pisum (pea aphid): 100158931Help
Entry
100158931         CDS       T01076                                 

Definition
MAGUK p55 subfamily member 5
Orthology
K06091  
MAGUK p55 subfamily member 5
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:api00001]
 Environmental Information Processing
  Signal transduction
   04391 Hippo signaling pathway -fly
    100158931
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1015 aa AA seqDB search
MDLSGYVLILKETEDNKAKLLGSKVDRADFETGDEIFAINGQQIAEMTRDDLLSYLYQCI
VTRTICMNLKPRVKKVVTTSIDSAGSDLGQVHDAFFIGIEDEAKERLERLAASKRITPVD
ITKLAHQLMRQLHPTTELNDFLDNKVHSGRVGSSCPPDNGNKLTEQADPKLSRRPSSPFN
NGHTEVLICKDVTDSNNRLKAVDETNETQNWSRRRSGGGLVRVGSEVGTLEKKRAVEDVT
GETLDMMVMMSALDNGPHREMAVDVPDSFIARNKTPPRYPPPSRANRTPGTQQNGSAVSE
RHAAPPPPPPRSDVIKQQLHQASINNNTIVTISSTEPTKEQLESIKKYQDALRKRKEEED
RVAQQNEFLNRSMRGSKKLRELEHEPPETGIVNDGFSSEQDEDNNRTTIGAVDDAEEESQ
DPYEPIYRVVGYGELIAALQRVHLQLKKNGIYINGKSDPDVAVIQCLLLNPEFVRVLSVH
NKVQQLWPPTTTKRPVTPEAQNLVRDCLENIHNSNLPEASELAKLLSQYEIEGVLWAHDT
IAQDVLPQDDEATTEVTVTLPVDDSSMYNTDQHPPNITIINIEKTNEPLGATVRNDGDAV
IIGRIVRGGAAEKSGLLHEGDEVLEVNGVEMRGKSINDVCDILSVMTGPLTFMIVPSANR
VTYQNINGNRENFIMHMKAHFDYDPEDDGYIPCRELGISFQKGEILHVISQEDANWWQAF
REGEEDQTLAGLIPSKSFQHQREALKQTITGEKPDKNKPKKQNTLLCGKKNLKKRKKKSL
YQDGGYPIYSSNSDEYEAEEILTYEEVALYYPRANHKRPIVLIGPPNIGRHELRQRLMED
RDRFAAAIPHTSRAKKDGEIDGQDYHFITRVQFESDILSRKFVEHGEYEKAYYGTSLDAI
RSVVNFSKICVLNLHPQSLKILRSSDLKPFVVFVAPPSLEKLRQKRLKNGEPYKEEELKE
IIEKAREMEDKFGHYFDMIIINNDTERAYHQLLNEINSLEREPQWVPATWVKTAS
NT seq 3048 nt NT seq  +upstreamnt  +downstreamnt
atggatctcagtggatacgtactaatactcaaagaaactgaagataataaagccaagctt
ttaggctcaaaagtcgaccgcgcggatttcgaaacaggtgatgaaatattcgcaattaat
ggacagcaaattgcagaaatgactcgcgacgatttattatcttatctctaccagtgtatt
gttacaagaaccatatgcatgaatttaaaacctcgagtaaaaaaagtcgtgacgaccagc
atagactcggcgggttccgatctaggtcaagttcatgatgccttcttcatcggaattgaa
gatgaagccaaagaacggttggaacggctggcggctagcaaacgtatcacaccagttgac
attactaaattggctcatcagttgatgcgtcaattgcacccaacaaccgaactcaacgat
tttttagacaataaggtacacagtggccgtgtcggttcttcatgcccaccggacaacgga
aataaattaaccgaacaagccgaccccaaattatctaggagacctagttcaccattcaat
aatggtcataccgaggttcttatctgcaaagatgtcaccgatagtaataatagactgaag
gctgtcgacgagaccaacgaaactcaaaactggtctcgtcgtagaagtggcgggggattg
gttcgcgtgggtagtgaagtcggtacgctggaaaaaaagcgagctgtcgaagacgtgaca
ggcgaaacgctggacatgatggtcatgatgagcgcgctggacaacgggccacaccgcgag
atggccgtcgacgttccggactcgtttatcgcccgcaacaagacgccgccgaggtaccca
ccgccgtccagggcgaaccgcacacccggaacccaacaaaacggttctgcggtatcagag
agacacgcggctccgccacctccaccgccccggtccgacgtaatcaaacagcagcttcat
caggccagcatcaacaacaacactatcgttaccatatcgtccaccgagcccactaaggag
cagttggagagcatcaaaaaataccaggacgcgctgcggaagcgaaaagaagaagaggac
agggtcgctcaacaaaacgaatttctcaatcggtcgatgagagggtcgaaaaaacttcgg
gagctcgaacacgaaccgccggaaacgggaatcgtcaacgacgggttttcgtcggaacag
gacgaggacaacaaccgcaccaccatcggtgcggtggacgacgccgaagaagaatcgcag
gatccgtacgagccgatatacagggttgtggggtacggtgaactgatagccgcgctccag
agggtacacttgcagctgaaaaagaacggaatctacatcaatggcaagtcggatccagac
gtggctgtgatccaatgcctattgctgaacccggaattcgtccgcgtgctgtccgtgcac
aacaaggtgcagcagttgtggcctcccaccacgaccaagaggccggtgactccggaagcg
caaaatttggtccgagactgtctcgagaacattcataacagtaacttgcccgaagcatcg
gaactcgctaaactattgtcccagtacgaaatcgaaggcgtgctctgggctcacgacact
atagctcaggacgtgttgccgcaagacgacgaggctactaccgaggtaacggtcacgtta
cccgtggacgattcatcgatgtacaacaccgaccaacatccccccaacatcacaataatc
aatatcgaaaaaaccaatgaaccattgggtgccactgttcgaaacgacggtgatgcggtg
atcatcggccgaatagtcagaggtggcgcagccgaaaaaagtggactgctccacgagggc
gatgaagtgttggaggtgaatggtgtagaaatgcgcggcaagtccataaatgatgtctgt
gatatcctgtccgtgatgactggacctctaacgttcatgattgtaccgagtgctaatcgg
gttacataccagaacataaacgggaaccgagaaaatttcatcatgcatatgaaagctcac
ttcgattacgaccccgaagacgatggttacatcccatgcagagaactgggtattagtttc
caaaagggtgagatcttacatgttatatctcaggaagacgccaactggtggcaggcgttc
agagagggcgaagaagatcaaacactggccggtcttatacccagcaaatcttttcaacat
cagcgtgaagcattaaaacaaaccataaccggcgagaagcctgacaaaaataaacccaaa
aaacaaaatacgcttctctgtggcaaaaagaacctgaaaaaaaggaaaaagaagtcacta
tatcaagacggaggttaccctatttattcgtccaactctgatgaatatgaagccgaagag
atactgacatatgaagaagtggccttgtattatccacgggcaaaccataaaaggccaatt
gtgttgattggcccacctaacattggccgacacgagctcaggcaaagattaatggaagac
cgtgataggtttgcagctgctattccccatactagccgagcgaaaaaagacggtgaaata
gatggtcaagattatcacttcatcaccagggttcagtttgaatcggacattctgtcgagg
aagtttgttgaacacggtgaatacgagaaagcttattacggcacgtcgctggacgccatc
cggtcggtggttaacttcagtaagatatgcgtgttaaacctacacccacagtcgttgaaa
attctccggagttccgatttgaagcccttcgtcgtgtttgtagctccaccgtccttggaa
aaactacgtcaaaagagactaaagaacggcgaaccttacaaagaggaagagctgaaagag
ataattgaaaaggcgagagaaatggaagacaagttcggccattacttcgacatgatcatc
atcaataacgataccgagagagcgtatcaccagttattaaacgaaataaatagtctagaa
agagaaccgcaatgggtgccagctacttgggtaaaaaccgcgtcatag

DBGET integrated database retrieval system