KEGG   Acyrthosiphon pisum (pea aphid): 100159009Help
Entry
100159009         CDS       T01076                                 

Definition
protein unc-13 homolog B
Orthology
K15293  
protein unc-13
Organism
api  Acyrthosiphon pisum (pea aphid)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2292 aa AA seqDB search
MEPEQNRNGGGRPTTTATAITTATATATATASTTTTNATTTVYGDQQAVEAALNEFIDKM
TPRVNVLENEVMYAWRALDLLSDEYVKMWERIEKLETIIQNQQSVIGQMVEICAEPITSP
STYMGPPEVGDRPALSMIWEESEGSSSNGTKKPLEQRNVDYRAYEDRLLNEDQEKMDSVE
SAKEIFENIEQMERNMRQLYAEAQLDSWNDETERAAAAIDFYPINKPLTSSVGNLQNRMY
PYMSPSIRSLPTIPKCEEPGYRSPTLFMDTTSQSTYMDDSYQPQSPPGSPPPPAPEDPVF
PRSVSSALSLSLRQFHNSTKELDSLHQFHNSTKDLDTMHQFHNSSKDLDTLHQHRTGAIV
TANKSDSGLSSMSGGLLSSYEKSPCSPGKRVFDQSYQISVAGPSGLTVVTCVTTAFDTDY
PYYDRSTGVYSTAGQGYKYQTTNAQQSSISNVPDLLDVMSYKEYKKPTDRPYSGMTDALT
YYPSTMNDTYYGRENDRPDNNPRYRYVTTPNFQIRCEDDGSRREEKTKKSKRNIIKSAMN
SVSSSVSNWFPDVHLPQRHRSHSLPGGLEREPDAVSVHSETATTSKPRSWNTQRHGSRKK
KKSIVSTMSGLLHKTAKPAPFQSSYSIADPEFAENEWTELKAGDRPTPPEPPPPVQPPES
ANIAIEQQEEEAQEQINEIQLPAEMFNGPTKEFAVSRKLSKYREHCKLSNGVPEGESSVI
PVEKRNKSLEEQPVKPHEEFVQPTNNLRNFKMSSRQASLEVPWAGKGSADTEDDSRSNHS
WRSTSRISSRRQSTEESIDSDDEWYCYELKQLEELEKKTHFERVFGPPMLPPPSARSESS
ILISKVDFKEKMSKAIEDIRRQSVDESFNEDAFEQEQSLDTVIEEELIQDDGPIRFKLMK
VPDTPGGIRRDLPGQDLDLEPEQEPEQETETADEQMVVEEDESPGTPSLPRFKFDKNDLV
DKEESGSKWKIVKALKEKKPDEINQDIGPPPTPIIENGRGSGENINRANGHPGDNPFYSN
IDSMPDIRPRRKSIPLVSELVLKTMAATKRNAGLASGVPRPTLNDEELKMHVYKKALQAL
IYPISSTTPHNFVSWTATSPTYCYECEGLLWGIARQGVRCTECGVKCHEKCKELLNADCL
QRAAEKSSKHGAEDKAISIIQAMKDRMLQRERDHPEIFELIRSVFGVEEKSHQGHIKAVK
QSVLDGTCKWSAKIAITVKCAQGLIAKDKSGTSDPYVTVQVGKVKKRTRTMPQELNPVWN
EKFYFECHNSSDRIKVRVWDEDNDLKSRLRQKLTRESDDFLGQTIIEVRTLSGEMDVWYN
LEKRTDKSAVSGAIRLHINVEIKGEEKVAPYHIQYTCLHENLFHSLCENNAGIVHLPQAK
GEDGWKLYFESPAQDIVDEFAMRYGIESIYQAMTHFHCLSTKYLCPGVPAVMSTLLANIN
AYYAHTTSSSAVSASDRFAASNFGKEKFVKLLDQLHNSLRIDLSMYRNNFPASSQEKLMD
LKSTVDLLTSITFFRMKVQELSSPPRASTVVKDCVKACLRSTYQFLFANCYDLYGREYQT
DPNEKRDEDTGPKLDDLGFWDKLVALVASVIEEDRNSYAPVLSQFPAELNIGQLSAATMW
SFFAVDMKYALEEHETHRLCKTSAYMNLHFKVKWLFTNYVKDAPPYKDAIPEYPSWFEPF
VMQWLNENDDVSLEYLHGAFNRDKKDGFQRSSEHALFSNSVVDVFTQLTQCFGVISKLEC
PDPEISNRYMKRLAKTIVKVLLAYVDIVQKEFDAKELDERTACILMNNIQQLRVQLTKMF
ESMGGKQLEEDATDILNDLQTQLLKALDELSGKFGKSLEPQIKKSVKELGELLQSIKGGS
QNPQQVSMMEVDEILRPLMDLMDGSLSLFAQTCEKPVLKRILRELWKLVIRILERSVVLP
PMMDKSMILKNLSENARSLAANARIEDMSRLIRNHMAGKQDVKNALTGVMDMEKNLNTKQ
CRVLESALKTIKTYFHAGGNGLKKKYLDKSSDLLSLCYALSLYTRSTDELIKTFVLSQLH
QVPQKNDPLPRQPSLMSGTEVKDEMDEMDYDEDDETEEEEALDEAEEDVKSMGSRMEKLF
EISRRPLQENYVYEEPYGEISINVYIETHPTNNEFKLTVTVVAANTLVWPTTGMFRPFVE
VNLIGPRLADKKRKQSTKSKSGSWSPRYNEAFVFSISAIEDLECYELHFCVKDYCFARED
RLVGVAVLQMRHVPIMVRTGEWLGLGRRIQMNETGWTILRILSQRYNDDVAKEFVKLKSE
TRQEDQSSVQGS
NT seq 6879 nt NT seq  +upstreamnt  +downstreamnt
atggaaccggaacaaaatcggaacggtggtggcagaccaaccactaccgccaccgccatc
accaccgccactgccaccgccaccgccaccgccagtactacaaccacaaacgcaaccact
accgtctatggcgaccaacaggctgtagaggctgcgctaaatgagttcatcgataaaatg
acaccccgcgttaacgtgttggagaatgaagtgatgtacgcatggcgagctttagactta
ttgtcagacgagtacgtaaaaatgtgggagcgtatcgaaaaactcgaaaccattattcag
aatcaacagtctgtcatcgggcaaatggttgagatatgtgcagagccgattacatctccg
tctacatacatgggaccaccggaagtcggtgaccgtcccgcgctaagtatgatatgggag
gaatcggaaggcagcagtagtaatggtactaaaaagccgttggaacagaggaacgtggat
tatagagcgtatgaagaccggctattaaatgaagaccaggaaaaaatggattccgtcgag
tctgccaaagagattttcgaaaatatagagcaaatggagagaaacatgcgacagctgtac
gccgaagcgcaactggatagttggaacgacgagacagaaagagcggcagctgctatagat
ttttatccaattaacaagccactcacgtcatcggttggaaacttacaaaatcgtatgtat
ccttacatgtctccgtccattcgatcgcttcccactatcccaaaatgcgaagaacccggg
tacaggtctccgacgttatttatggatacaacgtcacaatcaacttacatggacgactcg
tatcagccacaatcgccacccggtagtccaccacctccagcacccgaggatcccgtattt
cccagatcagtgtcatccgcactgtcactgagcctgcgtcaatttcacaattccaccaaa
gaacttgattcgcttcatcagtttcacaattccaccaaggacctggacaccatgcaccaa
tttcataattcctccaaagacttagacacgttacaccaacaccgaactggtgccatagtc
acggccaataaatccgattccggtctgtcatcgatgagtggcgggttgttgtccagttat
gaaaaatctccatgttcaccaggaaagcgagtgtttgatcaatcatatcagatctcggtg
gctggtccatccggattaacggtagtaacgtgcgtaaccactgcatttgacaccgattat
ccgtactatgatcggtcgacaggagtgtattcaacggcaggtcaagggtataaataccag
actactaacgcacaacagtcatcaatatctaacgtaccggacctgttggacgtaatgtcg
tacaaagaatacaaaaaacctacggatagaccatattctggtatgacagatgcgttaacc
tattatccaagtaccatgaacgatacgtattatggtagagaaaacgacaggccggataat
aatcctaggtatagatatgtgacgacgcctaactttcagatccgttgtgaagatgacggt
tcaagaagggaagaaaaaacgaaaaaatctaaacgtaatataatcaaatcagccatgaac
tcggtcagtagttcggtgagcaattggtttcccgatgtgcacttgccgcaacggcatcga
tctcattcactgccgggtggcttggaaagggaacccgatgcggtttccgtacacagtgag
acagcaaccacatcaaaaccgcgtagttggaacacacaaaggcatggtagtcgtaagaaa
aaaaaatcaattgtgtctaccatgtctgggctgttacataaaaccgctaaacctgcccct
tttcagagctcctattcaatagcagatccggaatttgcggaaaatgaatggactgagtta
aaagctggagataggccaacgccaccagaaccaccaccacccgtgcaaccaccagagtca
gctaacattgccatagagcagcaggaggaagaggcacaagaacagattaatgaaattcag
ttaccagctgaaatgttcaatggcccgactaaagaatttgcagtatccagaaagttgagt
aaatatagagaacactgtaagctatcgaatggagtgccagaaggggaatcttcagtaatt
ccagtagaaaaacgtaacaaatcattagaagaacagcctgttaaacctcacgaagagttt
gtgcagccaacgaataatctaagaaatttcaaaatgtcatctagacaagcaagtttagag
gtaccgtgggctggaaaaggatctgcggacactgaagatgatagtagaagtaaccattcg
tggagaagtacatctagaatttcgtcaagacggcaaagtactgaagaaagcatcgatagt
gacgatgaatggtattgttatgaactaaaacaattagaagaactagagaaaaaaactcat
tttgaacgggtatttgggccacctatgttaccaccacccagtgctcgaagtgaatcatcc
atacttatatctaaagtagattttaaagaaaaaatgtctaaagccattgaagacataaga
agacaatcagtagacgaatcgttcaacgaggatgctttcgaacaagagcaatccttggat
actgtcattgaagaggaattaatacaagacgacggacctataaggttcaagttaatgaaa
gtaccggatactccgggtggcattagaagggatcttccaggtcaagacctagacctggaa
ccggaacaggaaccggaacaggaaacggaaacggccgacgaacaaatggtcgttgaagag
gatgaaagtcccggtacaccgtcattgcccaggtttaaatttgataaaaacgatttagtg
gataaagaagagagtggcagtaaatggaaaatcgtgaaagctctcaaagaaaaaaaaccc
gacgagataaaccaggatattggacctccacctactccgattatcgagaatggaagaggg
agcggcgaaaacattaatagagcgaatggacaccctggagacaatccgttttatagcaac
atcgacagcatgccggatattcgacccaggagaaaatctatccctcttgtctcggaactg
gttctcaagacaatggccgccacaaaaagaaacgcaggactggcgtcaggagttccacgt
cctacactcaacgacgaagagctgaaaatgcacgtgtacaaaaaagctctgcaagctcta
atctatccaatatcatcgaccacgccgcataatttcgtctcgtggactgcaacttcaccg
acgtattgttacgaatgtgaagggctgctgtggggcatcgcccggcaaggggtacggtgc
accgaatgcggggtcaagtgccacgagaagtgcaaagagctcttaaacgccgactgtttg
caaagagcggccgaaaaaagttccaaacacggtgccgaagataaagcgatatcaattata
caggcgatgaaggacaggatgttgcaacgtgaacgagatcatccagagattttcgaactc
atcagatcagtgttcggcgttgaggagaaaagccatcagggtcatattaaagcggtgaaa
caatcggttttggatggtacttgcaagtggtcagcaaaaattgccatcacagtaaaatgt
gctcaagggctcatcgcaaaagacaaaagtggtacatcagatccatacgtaactgttcaa
gtgggtaaagttaaaaaaagaacgcgaactatgcctcaagagctcaatcctgtttggaat
gaaaaattttatttcgagtgccacaattcttcggatcgaattaaagtcagggtatgggac
gaggataatgacctgaaatcgagactcaggcaaaaattaaccagagaatcggacgatttt
ttaggacaaactattatcgaggttcggacgttgtcgggcgaaatggacgtttggtacaat
ctcgaaaaaaggactgataaatcggcggtatccggtgctattcgattacatatcaatgta
gaaatcaaaggagaggaaaaagtcgctccttaccatatccaatacacgtgtctccacgaa
aacctgtttcactcgctgtgcgaaaacaacgctggaatagttcacctacctcaagctaag
ggagaagacgggtggaagttgtactttgaatctcccgcgcaagatattgtcgacgagttc
gccatgagatacggcatcgagtccatttaccaagcaatgacacacttccattgtctctcg
acaaaatatttatgccctggcgtcccagcggtaatgagtactttgttagcgaatatcaat
gcctactatgcacacacaacatccagctccgccgttagcgcgagcgaccgttttgcagca
tcgaatttcggaaaagaaaaattcgtgaagctgctcgatcaactacataattcgctcaga
atagatttatcaatgtatagaaataactttccggcatccagtcaagaaaaattaatggat
cttaaatcgactgtcgatttgttgaccagtatcacatttttcagaatgaaggtacaagaa
ctttcaagtccacccagagctagtaccgttgtcaaggactgcgtcaaagcatgtctaaga
tcgacttatcaatttttgtttgctaattgttatgatttatacggcagagaatatcagact
gatccaaatgaaaagagagatgaagacacgggtccaaagttagatgatttaggattttgg
gataagcttgtggcactcgttgcttctgtaatcgaagaagatagaaatagttatgcaccc
gttttgagtcaattccccgcagaactcaatataggacagttgtccgcagcaacaatgtgg
agcttcttcgctgtagacatgaagtatgctctagaagaacatgaaacacacagactttgt
aaaacttcagcatacatgaacctacatttcaaagtaaaatggttgtttactaattatgta
aaagatgcaccgccatacaaagacgcaattcccgagtacccatcttggtttgaaccgttt
gtaatgcaatggctaaatgaaaacgacgacgtgtcgttggaatatttgcatggagctttc
aacagggacaaaaaagatgggtttcaaagaagttcggagcatgcgttattttccaactca
gtggtggacgtattcactcagcttacacaatgttttggggtcatatcgaaattggaatgt
cctgaccccgagatatccaatcgatacatgaaaagacttgctaagacaattgtcaaagtg
ttattggcatacgtagacatagttcaaaaagaatttgacgctaaagagctggatgaaaga
actgcttgtatattaatgaataacatccaacaactaagagtacaactaacaaaaatgttc
gaatcaatgggtggcaaacaactggaagaagatgctacagatattctaaacgacttacaa
acgcaattattaaaagcattggatgaactatctgggaaattcggaaaaagtttggaaccc
caaataaagaaaagcgtcaaagaacttggtgagttattgcaaagtatcaaaggaggtagc
caaaatccacaacaagtgtctatgatggaagtagatgaaatattaaggccattgatggat
ctaatggatggctcattatcattatttgctcaaacttgcgagaaacccgtactaaaacga
attcttcgtgaactgtggaaacttgtaataagaatattggaaagatcagtagtcttacca
ccgatgatggataaaagtatgatattgaaaaaccttagtgaaaacgctagatcactagca
gctaatgctagaatcgaagacatgtccagattaattagaaaccacatggcaggaaagcaa
gacgttaaaaatgctctaactggagtgatggatatggaaaagaacttgaatactaagcag
tgcagggtcttagaatctgcactgaaaacaattaagacttatttccacgccggtggaaat
ggactaaaaaagaagtatttagataaaagctcagatcttttatctttgtgctacgctttg
tcactttacacaagatccacagacgaactcatcaagacgtttgtgttatcacaattacat
caagttccacaaaaaaatgacccattacccagacaaccgtcactgatgagtggtaccgag
gtaaaagatgaaatggacgaaatggattatgatgaagatgacgaaaccgaagaggaagaa
gcattagatgaagcagaagaagatgtaaaatcaatgggaagtcgaatggaaaaactattt
gaaatttcaagaagaccattacaagaaaattacgtatatgaagaaccttatggagaaatt
tccattaacgtttacattgaaacacatccaacaaataacgaatttaagctcactgtaaca
gtggtcgctgccaacacactggtatggccgacgactggtatgtttcgcccgtttgtcgag
gtgaacctcattggaccgagactagcggacaagaagagaaaacagtcgacgaagagcaag
tcgggcagttggagccctagatacaacgaagcgttcgttttttcgattagcgccatcgaa
gacttggaatgttacgaattacatttttgcgtgaaagactactgtttcgctcgagaagat
cggctcgtcggcgtggcggttttgcagatgcgacacgttcccataatggtccgtacgggc
gagtggttaggcctcggcaggcggatacagatgaacgagactgggtggacgattttgcga
atactttcacagaggtacaacgacgacgtagctaaggaattcgtgaagctcaagtcggag
accaggcaggaagaccagtcatccgtgcaggggtcataa

DBGET integrated database retrieval system