KEGG   Acyrthosiphon pisum (pea aphid): 100159205Help
Entry
100159205         CDS       T01076                                 

Definition
NADH-cytochrome b5 reductase-like (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100159205
Enzymes [BR:api01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     100159205
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 309 aa AA seqDB search
MGILEELTVSSVLVGLGIVVTTGFAISAFVANFQKKSQKKRTLVDSNTKIPLPLIQKHII
SHDTRRFRFELPSKNHILGLPIGQHIHLSARINEELVARAYTPVSSDNDVGYMDLVIKVY
FRDQNPKFPDGGKLTQYLEKMEIGDTIDVRGPSGRLIYHGRGDFEIKAVKRIDPSHNLYA
KKISMIAGGTGITPMLQLIRQVTRDPKDETKLSLLFANQTEEDILLRDELEEAVKSHPDR
IKVWYTVDRPTDGWKYSVGFISSDMISEHLYPPAQDTLVLMCGPPPMINFACIPNLDKLG
YDAKLRFSY
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgggcattcttgaagagcttactgtttcttcagtgttggttggacttggaattgttgtg
actactggttttgctatatcagcatttgtagccaatttccaaaagaaaagccaaaaaaaa
agaacattagtggattcaaatacaaagattccattgccacttattcaaaaacatattatt
agtcacgacacacggagatttagatttgaattgccatccaaaaatcatattcttggttta
ccaatagggcaacatatacatttatcagcgagaataaatgaggaattggttgcccgtgcc
tacacaccagtcagtagtgacaatgatgttggatatatggatttggttattaaagtttat
ttcagagaccaaaatcctaagttccctgatggtggtaaattaacgcaatatcttgagaaa
atggaaattggagacacaattgatgttcgtggaccttctggtcgtctcatatatcatggt
cgtggagattttgaaattaaagctgttaaaagaatagatccttctcataacctttacgct
aaaaaaatatcaatgattgctggtggtactggtattacaccaatgttacagttgattaga
caagtcactagagatcctaaagatgaaaccaaattgtcattactttttgccaatcagact
gaagaagatatattattaagggatgaattagaagaagctgttaaaagtcatcctgatcga
atcaaagtctggtatacggttgatagacctactgatggatggaagtatagtgttggattt
atatcatctgacatgatatcagaacatctatatccaccagctcaagatacattggtattg
atgtgtggacctcctccaatgataaactttgcatgtattccaaatcttgataaacttgga
tatgatgccaagttaagattttcttattaa

DBGET integrated database retrieval system