KEGG   Acyrthosiphon pisum (pea aphid): 100159252Help
Entry
100159252         CDS       T01076                                 

Definition
putative glucose-6-phosphate 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100159252
Enzymes [BR:api01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     100159252
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 202 aa AA seqDB search
MTCRWNVEKQPEPLDNGDIEALFSLVDNSVTKQMWNYSFKLVLRVILREKELQVSFNLYN
SSLEPFQFNMLFHTYLKVPDVRKCNISGLQGCMYVDKTKENGVYQEPREMVTVNHWTDRI
YQNTQQEHVISNVVSGRKMKMIKYNMPDTVVWNPWDVTSSTMSDFGEDEYPNMICVEAGI
VINPITLNPNNTYEGTIILQVM
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacatgcagatggaatgttgaaaaacaacctgaaccattagacaatggtgacattgaa
gcactattttcattagtggacaattccgttacaaaacaaatgtggaattatagtttcaaa
ttagtgctaagagtaatattgagagaaaaagaattacaagtcagtttcaatttatacaat
tcatctctagaaccatttcaatttaacatgcttttccatacatatctaaaagtaccagat
gtccgaaaatgtaatatatctggccttcaaggatgcatgtacgtagacaagaccaaggaa
aatggtgtataccaagaaccgagagaaatggtgactgttaatcattggactgatagaatc
tatcaaaatacacaacaggaacatgtgatttcaaatgttgtatccggaagaaaaatgaaa
atgataaaatacaatatgccagatacagttgtatggaatccatgggatgtaacatcaagt
acaatgagtgactttggtgaagacgaatacccaaatatgatatgcgttgaagctggcata
gtaatcaatccaataacactgaatccaaataacacatatgaaggcactataattttacag
gttatgtga

DBGET integrated database retrieval system