KEGG   Acyrthosiphon pisum (pea aphid): 100159255Help
Entry
100159255         CDS       T01076                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L5-like
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100159255
Peptidases [BR:api01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100159255
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 322 aa AA seqDB search
MSDSVGWCLIESDPGVFTELIRELGVTGAQVEELWTLDSSLFDAIKPVHGLIFLFRWIGE
DQPDGPIVRDSRIEKLFFAKQVINNACATQAILSVLFNCRHPDIELGTTLSEFKEFSQKF
DANMKGLALSNSQKIRSVHNSFGRSNSIFEFDDTAKPKSKDDEAYHFVAIVPIEGRLYEL
DGLKEGPIDLGLIKPNTDWVEAAKPFIEKRINKYKEGEVHFNLMAVVSDRKLILEQRLLS
LKTEELDEATKISEESNIRMKIADEEDKMKRYKIENARRKHNYLPLIVEILKLLAKDGKL
VPLYERAKAKTLEKEKQKIGKV
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtctgattccgtgggttggtgcttaatcgaaagcgatcccggtgtgtttacggaactg
atccgcgaacttggtgtgaccggagctcaggttgaagaattatggacactggacagcagc
ttgtttgacgcaatcaagcctgttcacggtttaatattccttttccggtggataggagaa
gaccaacctgatggaccgattgtcagagattcgagaattgaaaagttattttttgctaaa
caggttataaataatgcttgtgctacacaggctattttaagtgtattatttaactgtcgt
catccagatattgaacttggcactaccctaagcgaattcaaagagttttctcaaaagttt
gatgctaatatgaaaggtttggccttaagtaattctcaaaaaattcgctcagtgcataat
tcttttggaaggagtaattctatttttgaatttgatgatactgctaaaccaaaatcaaaa
gatgacgaggcttatcattttgttgcaattgtgcctattgaaggtcgtctttatgaatta
gatggattgaaagaaggtccaattgacttaggattaataaaacccaatacagattgggtt
gaagctgcaaaaccatttattgaaaaaagaataaataaatataaggaaggagaagttcat
ttcaacttaatggcagtagtatccgataggaaattaattttagaacaacgactattgagc
cttaaaacagaagaattggatgaagcaacaaaaatttctgaagaaagtaacatccgtatg
aaaattgctgatgaggaagataaaatgaaacgatacaaaattgaaaatgcccgccgtaaa
cataattatttaccattaattgtggaaatattgaagttattagccaaagatggaaagttg
gtaccattgtacgaaagagctaaagcaaaaaccttagaaaaagaaaaacagaaaattggc
aaagtttaa

DBGET integrated database retrieval system