KEGG   Acyrthosiphon pisum (pea aphid): 100159396Help
Entry
100159396         CDS       T01076                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase dSOR1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api04013  MAPK signaling pathway - fly
api04068  FoxO signaling pathway
api04140  Autophagy - animal
api04150  mTOR signaling pathway
api04320  Dorso-ventral axis formation
Module
api_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:api00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    100159396
   04068 FoxO signaling pathway
    100159396
   04150 mTOR signaling pathway
    100159396
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100159396
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    100159396
Enzymes [BR:api01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100159396
Protein kinases [BR:api01001]
 Serine/threonine kinases: STE group
  STE7 family
   100159396
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Seadorna_VP7 Kinase-like Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 100159396
NCBI-ProteinID: XP_001948295
APHIDBASE: ACYPI000770
UniProt: J9JKR8
Position
Un
AA seq 401 aa AA seqDB search
MSKNKLNLTLPPGVADNQQPVSPSAPLSAASDAGCDKLSVASLQEQLDRVGMDDEQRKRM
ELFLCQKEKIGGELSDADFEKMKDGELGAGNGGVVMKVKHKSSGLIMARKLIHLEVKPAI
KKQIIRELKILHECNHAHIVGFYGAFYSDGEISICMEYMDGGSLDLILQKTRIPEPMLGT
ITAAVVKGLIYLREQHSIIHRDVKPSNILVNSAGEIKICDFGVSGQLIDSMANSFVGTRS
YMSPERLQGTQYTLQSDIWSLGLSLVEMAIGMYPIPAPDAKTLASIFGPRSQATETIENI
EGDVFANGNGPRPMAIFELLDYIVNEPPPTLPAGIFSDAFKDFVDRCLKKNPNERGDFKM
LMDHQWIKKAESEPVDIAGWVCKIKGLTPTTPTRMASNSAS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagaacaaattaaacttgacccttcctcctggtgtggctgacaaccaacagcct
gtgtcaccatctgcaccattatcggcagcatcagacgcaggatgcgacaaattaagcgta
gcaagtctacaagaacaattggatcgagtcggaatggacgacgaacaacgaaaacgaatg
gaattatttttatgtcaaaaagaaaagattgggggtgaacttagtgatgcagactttgag
aaaatgaaagatggtgaactaggtgccggcaacggtggagtagttatgaaagtcaaacac
aagtctagcggacttatcatggccagaaaactcatacacttagaagtaaagcctgcaata
aaaaaacaaatcattcgggaacttaaaattttgcatgaatgtaaccatgcacacatagtt
ggtttttatggagcattttacagtgatggtgaaattagtatttgcatggaatacatggat
ggcggttcccttgatctcatattgcaaaagactagaatacctgagccaatgcttggaact
ataactgctgctgttgtcaaaggtctgatttatcttcgagaacaacattccattattcac
agagatgtcaaacccagtaacattttggttaacagcgcaggggaaattaagatatgtgat
tttggtgtgtctggtcaattaatagactctatggctaactcatttgttggtactagatca
tatatgtctcctgaacgactacaaggtacacaatatacattacaaagtgatatatggtcc
ttgggattatctttggttgaaatggccattggaatgtatcccatacccgcacctgatgct
aagactctagcatcaatatttgggcctagatctcaggcgactgaaacaatagaaaatatt
gaaggtgatgtcttcgcaaatggaaatggacctaggccaatggccatttttgaactcctt
gattacattgttaatgaaccacctcctacattaccagctggtatattctctgatgccttc
aaagattttgtagacagatgcttaaagaaaaatcccaatgagagaggagatttcaaaatg
cttatggatcatcaatggataaagaaagcggaaagtgaaccagttgacatcgctggatgg
gtttgcaagataaaaggtttaactccaactactccaaccagaatggcttcgaattcagca
tcatga

DBGET integrated database retrieval system