KEGG   Acyrthosiphon pisum (pea aphid): 100159396Help
Entry
100159396         CDS       T01076                                 

Definition
dual specificity mitogen-activated protein kinase kinase dSOR1-like
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:api00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    100159396
   04068 FoxO signaling pathway
    100159396
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    100159396
Enzymes [BR:api01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100159396
Protein kinases [BR:api01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100159396
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 401 aa AA seqDB search
MSKNKLNLTLPPGVADNQQPVSPSAPLSAASDAGCDKLSVASLQEQLDRVGMDDEQRKRM
ELFLCQKEKIGGELSDADFEKMKDGELGAGNGGVVMKVKHKSSGLIMARKLIHLEVKPAI
KKQIIRELKILHECNHAHIVGFYGAFYSDGEISICMEYMDGGSLDLILQKTRIPEPMLGT
ITAAVVKGLIYLREQHSIIHRDVKPSNILVNSAGEIKICDFGVSGQLIDSMANSFVGTRS
YMSPERLQGTQYTLQSDIWSLGLSLVEMAIGMYPIPAPDAKTLASIFGPRSQATETIENI
EGDVFANGNGPRPMAIFELLDYIVNEPPPTLPAGIFSDAFKDFVDRCLKKNPNERGDFKM
LMDHQWIKKAESEPVDIAGWVCKIKGLTPTTPTRMASNSAS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagaacaaattaaacttgacccttcctcctggtgtggctgacaaccaacagcct
gtgtcaccatctgcaccattatcggcagcatcagacgcaggatgcgacaaattaagcgta
gcaagtctacaagaacaattggatcgagtcggaatggacgacgaacaacgaaaacgaatg
gaattatttttatgtcaaaaagaaaagattgggggtgaacttagtgatgcagactttgag
aaaatgaaagatggtgaactaggtgccggcaacggtggagtagttatgaaagtcaaacac
aagtctagcggacttatcatggccagaaaactcatacacttagaagtaaagcctgcaata
aaaaaacaaatcattcgggaacttaaaattttgcatgaatgtaaccatgcacacatagtt
ggtttttatggagcattttacagtgatggtgaaattagtatttgcatggaatacatggat
ggcggttcccttgatctcatattgcaaaagactagaatacctgagccaatgcttggaact
ataactgctgctgttgtcaaaggtctgatttatcttcgagaacaacattccattattcac
agagatgtcaaacccagtaacattttggttaacagcgcaggggaaattaagatatgtgat
tttggtgtgtctggtcaattaatagactctatggctaactcatttgttggtactagatca
tatatgtctcctgaacgactacaaggtacacaatatacattacaaagtgatatatggtcc
ttgggattatctttggttgaaatggccattggaatgtatcccatacccgcacctgatgct
aagactctagcatcaatatttgggcctagatctcaggcgactgaaacaatagaaaatatt
gaaggtgatgtcttcgcaaatggaaatggacctaggccaatggccatttttgaactcctt
gattacattgttaatgaaccacctcctacattaccagctggtatattctctgatgccttc
aaagattttgtagacagatgcttaaagaaaaatcccaatgagagaggagatttcaaaatg
cttatggatcatcaatggataaagaaagcggaaagtgaaccagttgacatcgctggatgg
gtttgcaagataaaaggtttaactccaactactccaaccagaatggcttcgaattcagca
tcatga

DBGET integrated database retrieval system