KEGG   Acyrthosiphon pisum (pea aphid): 100159504Help
Entry
100159504         CDS       T01076                                 

Definition
histone-lysine N-methyltransferase Suv4-20-like
Orthology
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:api00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 276 aa AA seqDB search
MKPQELCDIDDLATSLVVDVFLGFNTHKMNTEHEEKYKCKSHLKPVIDEFIKNQSMEIAF
DSFWNLKYIPDHLFKAFYKKLVRDHIERYMRMFYLDSGFRIEPCYRYSLENKVGAKVNAT
NHWYKDEIIKQLVGCVAELTEKEEDEILHFGKNDFSVMYSCRKKCAQLWLGPAAYINHDC
LANCKFVPNDKGTACVKVLRDIKPGDEITCFYSDNFFGENNVNCECYSCEKLCKGAFKTN
EEQPKLRRYNFRQTNGRTNSYRSLYKSENVKGPKTP
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctcaagaactgtgtgatattgatgacttagctacatctcttgttgtcgatgtt
ttcctcggatttaatacccataaaatgaacacagaacatgaagaaaagtataaatgtaaa
tcacatttaaaacctgttattgatgaattcataaaaaatcaaagtatggaaatagctttt
gattctttttggaatctaaagtatatacctgatcatttattcaaagcgttttataaaaaa
ttagtcagagaccatattgaaagatacatgagaatgttttatttggattcaggtttccga
attgaaccatgttacagatactctttagaaaataaggtaggagccaaagtaaatgccacc
aatcattggtataaagatgaaattattaaacaattagttggttgtgtggctgagttgaca
gaaaaagaggaggatgaaatattgcattttggaaagaatgatttttcagtgatgtacagc
tgtcgcaaaaagtgtgctcaactttggctgggcccagcagcgtatatcaaccatgattgc
ctggccaattgtaagtttgtacctaatgacaaaggaacggcctgtgttaaagtactcaga
gatattaaacctggtgatgaaataacatgcttttatagtgataatttctttggtgaaaac
aatgttaactgtgagtgctattcgtgtgaaaagttgtgtaaaggagcttttaaaaccaat
gaagaacaaccaaaattgagaaggtacaacttcaggcaaactaatggtcgaaccaattct
taccggtctctttataaaagcgaaaacgtaaagggaccaaaaacaccttaa

DBGET integrated database retrieval system