KEGG   Acyrthosiphon pisum (pea aphid): 100159564Help
Entry
100159564         CDS       T01076                                 

Definition
glycogen debranching enzyme-like
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:api00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1520 aa AA seqDB search
MGGQPTKIQNKAMYVKPQNNNKMRIVTLEDGHFQDETLYRLKKGWYLEFRMGPSLFGRDV
TIYTNIPAEGSAFDRKTYRCLDWIREWSSDDTIIDDSSLSCLIQMNKAGSFHYYYEHKGQ
KKGCGYINVDPDLVAGNKDIPLESLQAVSVLAKCLGPFSSWKSKLQVAKESGYNMVHFTP
IQELGGSKSSYSLKNQLVLNPSFNDCNHQVTFGDIKSLTDEMKNEWNMLSICDIVLNHTS
NDSPWLLEHPESAYNLVNCPYLRPAYLLDYTLYHFTVEVSKGMWEFYGVPVIINSEEHLA
SIRHALLTAVLPKVKIHELFQLNIDKIVAEFQEKVRVGPPPVATNEKLDEELTIIPDLEF
GRLTATIDMNKALKLYNIYRSNCFDEDTRLGRCSLELKLKLETLNNIVFNEVQGHLIAAV
DNSIAGIRYFRVQPDGPKLTKVSITNPLVPRYFTDYEGQTAEEVLHSSNGQFVMAHNGWV
MGGDPLKNFAGPDSNIYLRRELIAWGDSVKLRYGNEPKDCPFLWNHMQCYVEQIVKIFDG
VRLDNCHSTPLHVAEYLLDAARKVKPDLYVVAELFTNSDATDNIFVNRLGITSLIREAMS
AWDSHELGRLVHRYGGDPVGGFFKPLEQLVCPTIAHALFMDQTHDNPSPIEKHSVYNLLP
SAALVSMACCASGSNMGYDQLVPHHIHVVEEERQYMQWSSKEINITTGIVAGKKSLNALH
YNLGKGGFDQVYVDQIDTDIVCVTRHNSKTHESVVLMSYTSFSTPSNQNGLGKGITVTGR
VDNVLIETSLQHMILDNTNEFEKDANKINGLEDYVLSLRQNVTPQECLMLDIIPSADKFS
VRLNFTAKFQPGCVVAVEIFPVEKTKIAVEQLLSDIDLEQAVSRLTLSDMNYVLFRCPEE
DEGNVYDVPGFGKLVYCGIQGFMSILDTVSQNNDLGHPLCENLRKGFWILDYISGRLKRK
EFENCALYQFGDFLERYLQPIRNLPSYLVPCYFEFSLRKVYNALLNRTWSMMPSDIRNGS
TFCKNLALASIQFAGVVKSSPLPTLSPNLLAPLLRTQIGPDGLYRPECITLAAGLPHFSS
GYMRNWGRDTFISLRGLLLITGRYEEAKYIILGFGGCLRHGLIPNLLDGGNNPRYNCRDA
VWWWLYVIQKYVTMVPGGISILDDPVNRIFPNDDSEPTSVEQPLHEVIQEVMVKHFQGLC
FRERNAGTSIDAHMKSAGFDNQIGVQPLTGFVFGGNEWNCGTWMDKMGSSDKAGNRGRPA
TPRDGSAIELVALSKTTVAWLAKLKKNGQFKYSGVTRTNKDGSETTWTYKEWNEKIQNNF
EIHFWIPEEKNSRMQVEPHPELINRRCIYKDTVGATNKWGDYQLRCNYAVAMAVAPELFN
PDHARIALQTVTNVLLGPLGMKTLDPSDWAYDGFYNNDNDTTDLKVANGFNYHQGPEWLW
PVGFFLKAKLTFSTSQRETSSEIQGILSKHFEHIKTSVWKGLPELTNKDGAFCAGSCPTQ
AWSVATILETLMAITNLNQI
NT seq 4563 nt NT seq  +upstreamnt  +downstreamnt
atgggaggacaacccaccaaaatccagaataaagctatgtatgttaagccacagaataac
aataaaatgcgtattgtgacattggaagacggtcattttcaagatgaaacactatataga
ctgaaaaaaggctggtacttagaatttcggatgggcccatcactttttggacgtgacgtt
actatttacactaatataccagcagaaggatcagcctttgatagaaaaacttatcgttgc
cttgattggatcagagaatggtcaagtgatgatacaattattgatgattcgtctttgtct
tgtcttatccagatgaacaaagctggatcttttcattattattatgaacataaagggcaa
aagaaaggatgtggttatattaatgttgatccagatttggttgctggaaataaagatata
cctttagaatcgttgcaggctgtatctgttttagcaaaatgtttaggaccattttcttca
tggaaatctaagttacaagttgcgaaagagtctggatacaacatggtgcattttacaccc
attcaagagcttggaggttcaaaatcatcatacagtttgaaaaatcaattggtgttaaat
ccttctttcaatgattgtaatcatcaagttacatttggtgatattaagtctttgactgat
gaaatgaaaaacgaatggaatatgttaagtatatgtgatatagtgttgaatcatacatcc
aatgatagtccatggctattggaacatcctgaatctgcttacaacttggttaattgtcca
tatttaagaccagcttatttgttagattatactttatatcactttactgtggaagtttct
aaaggtatgtgggaattttatggagttcctgtgattatcaatagtgaagaacatcttgca
tccatacgacatgcattattaacagcggtattaccaaaagtaaaaattcatgagctgttt
caattgaatattgacaaaatcgtagctgagtttcaagaaaaagttcgtgttggtccccct
ccggtagctacaaatgaaaaacttgatgaagaattaacaatcatacctgatttagaattt
ggccgattaacagctacaattgatatgaacaaagcattgaaattatacaatatatatagg
agcaattgttttgatgaagatactaggcttggtcgttgcagtttagaattgaaattaaag
ttggaaactttgaacaatatagtgtttaatgaagttcaaggacatttaatagctgcagta
gataatagtattgctggtataagatatttcagagttcaaccagatggacctaaattgacc
aaagtttctattactaatcctctagtaccaaggtattttacagactatgaaggtcaaact
gctgaagaggtattgcattcttcaaatggacaatttgttatggcacataatggatgggtt
atgggtggtgatccacttaaaaattttgctggaccagactctaatatttatttacgtaga
gaattaattgcctggggagacagtgtaaaattaagatatggaaatgaacctaaagattgc
ccatttttatggaatcatatgcagtgttatgtggaacaaatagttaaaatatttgatggt
gtcagattagataattgccattcgacaccattgcatgtagctgaatatttgcttgatgct
gctcgaaaagttaaaccagatttatatgttgtggcggagttgtttacaaattcagatgct
actgacaatatatttgttaatagacttggaattacatcacttattcgtgaagcaatgtct
gcatgggattcacatgagcttggacgcttggttcaccgttatggtggtgatccagttggt
ggattttttaaaccactagaacaacttgtatgtcctactattgcacatgctcttttcatg
gatcaaactcatgataatccatctcctatagagaaacattcagtttataacttgttgcct
agtgcggctttagtatccatggcatgctgcgctagtggaagcaatatgggttacgatcaa
ctagttccacatcatattcatgttgttgaagaggaaagacaatatatgcaatggtcatcc
aaagaaattaatattactacagggatagtagctggaaaaaaatcattaaatgcacttcac
tataatctgggaaaaggtggttttgatcaagtctatgtggatcaaattgatactgatatt
gtttgtgtgacacgtcataatagtaaaacgcacgaaagtgttgtactaatgtcatatact
tccttttcaactccatctaaccaaaatggtttgggaaaaggcataactgtaactggaaga
gttgataatgtactaattgaaacttcattgcaacacatgatattggacaatacaaatgaa
tttgaaaaggatgcaaataagatcaatggcctagaagattatgtactgagcttaagacaa
aatgttactcctcaagaatgtttaatgttggatataataccttcagctgacaaattttct
gttagattgaattttactgcaaaatttcaacctggttgtgtagtagcagttgaaattttt
ccagtagagaaaacaaaaatagctgttgaacagttattgtctgatattgatttggaacaa
gcagtgagtcgtttaaccctatccgacatgaattatgttttgttcagatgtcctgaagaa
gatgaagggaatgtttatgatgtaccaggatttggtaaattggtgtattgcggaatccag
gggttcatgtcaattttagatacagtgtctcaaaataatgatttaggccatccactatgt
gaaaatctccgaaaaggtttttggattctagattacataagtgggcgtttaaagcgtaaa
gaatttgaaaactgcgcattgtatcaatttggagactttttagaaagatatttacagccc
atcaggaacttgccatcatatttggttccctgttattttgaattttccttgagaaaagta
tacaatgctttgttgaaccgcacatggtcaatgatgcctagtgacataagaaatggttct
acattttgtaaaaatttagctcttgcttcaattcaatttgctggagtagttaaatctagt
cctcttcctactctctcgccaaaccttttagcacctttactcagaacccaaattggacct
gatggattatatcgtcctgagtgtataacacttgcagctgggctgccacatttttctagt
ggttacatgagaaactggggccgagatactttcatttcgttgagaggattattgttgatt
actggacgttatgaagaagccaagtacattattttaggatttggtggttgtttgagacat
ggtcttattcctaatctattagatggaggcaataacccacgttataattgtcgtgatgct
gtttggtggtggttatatgtaattcagaagtatgttactatggtacctggaggtataagt
attttagatgatccagtaaatagaatttttccaaatgatgattcggaacccacatcagtt
gaacaaccattacatgaagtaattcaagaggttatggtaaaacatttccaagggttatgt
tttcgtgaacgtaatgccggaacttctattgatgcccacatgaaaagtgctggctttgat
aatcaaattggagtacaacctctaacaggctttgtgtttggtggtaatgagtggaattgt
ggtacttggatggataaaatgggttcctcagataaagctggtaaccgaggacgacctgct
acccctcgtgatggatcagctatagagttggttgcattgtcaaagacaactgtcgcatgg
ttagctaaattgaaaaaaaatgggcagtttaagtattcaggagttacccgtacaaataaa
gatggatcagaaactacgtggacatataaagaatggaatgaaaaaattcaaaacaatttt
gaaatccacttttggatacccgaggaaaaaaatagtcgaatgcaagttgaacctcatcca
gaacttattaatcgtagatgtatttataaggatacagttggtgcaacaaacaaatgggga
gactatcaactgcgatgcaattatgctgtagcaatggcagtggcaccagagttgtttaac
ccagatcatgcaagaatagctttgcaaacagtaacaaatgtacttctagggccactgggt
atgaaaactctagatccatctgattgggcatatgatggcttttacaataatgataacgat
actactgatttaaaagtagccaatggtttcaattatcaccagggacctgaatggttgtgg
cctgttggtttctttttaaaagcaaagctaacattttccacaagtcaacgagaaacttca
tctgaaattcaaggtatactatctaaacattttgaacacataaaaacatcagtttggaaa
ggattacctgaattaaccaataaagatggagctttttgtgctggatcatgtccaactcaa
gcctggagtgttgctacaattcttgagactttaatggctattacaaacttgaaccaaatt
taa

DBGET integrated database retrieval system