KEGG   Acyrthosiphon pisum (pea aphid): 100159712Help
Entry
100159712         CDS       T01076                                 

Definition
protein son of sevenless-like
Orthology
K03099  
son of sevenless
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:api00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    100159712
   04630 Jak-STAT signaling pathway
    100159712
   04068 FoxO signaling pathway
    100159712
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    100159712
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1210 aa AA seqDB search
MASKSFPKAEIEKFLCIQTNPTKWKGLLIGSLTKIVDQVHPLLAVSDEALACVEMLIVQC
LEILTLRSSPPYTRFDIEDQVKRWFPKPIDKWAIKDANEAIEKNKKKHHLILPTDKIHNL
VQKELIQYKLDYTVALYITAVLEYMAADILKLAGNYVNNIHHVEISYQDLCVAICGDKVL
MDLFSQHDNNGDLNLSELSIDKIQRITTYEEVIKDLMHDEKQLVRDLYLILKVFKEEINR
AIPVGTCQELDNMFDNIAEICKTTKLFLSSIEDILEISDDKFTTIGCCIEEFAETAEFDV
FELYANDIVNKQCRNIFWNLISKPEVSNSLQSTGFKEALKYYFPKLLLLPIWHCILYFDY
FRILHQLSPSRHDKECLEQAEGMFKPLQLKMISIANQINLKDNVKEFGLKINATPRRLLA
IEKLQKMQKSIDGWDGKDMGQCCTEFIREGILLKVSSGGKRCSERKAILFDGVLILCKSN
SKKTSALVSSQLVGNLSEFKFKLKEKLFIRKVDIFDRDDTDETKHIFEIFPRLEPPITLV
ARTFEDKANWMADLLMLTSKSILDRTLNNILLDEDKKFPLWLPSVEEYRFVEPDSRSNII
FEEKENNGIPLIKGAILLKLIERLTYHIYADPKFVKTFLTIYRSFCSPHDLMDLLIERYK
IPEPSGITLNSESLRDETKRFKKEYLIPVQFRVLNVFRHWVDYHYYDYQCYPYLLDKLYE
FLDSINGKSIKKLTDSLIKIIHRKTSEAQKEITFAFDSPPPAIEVHMDFNGNDKFNILLV
HPLEFARQLTLIESENYRAVKPSELVGSVWTKKDKEINSPNLLRLIKRTTNFSRWIEKTV
VECENIEERVATVSRFIEVMMALYQLNNFNGVLGVFSAMSSAAVFRLKFTMQSLNAKLDK
GLEEARNLSINHFKKYQDKLRSINPPCVPFIGMYLTNILHIEEGNPDCLTNNPNLINFNK
RRKVAEIIEEIQQYQNQPYCLNVEPKIKKFLENLNPFNDMKDTDINNYLYSKSLEIEPRN
CKQLPKYPRKWPDLNLKSPGLKPKSRVPSVSSKEMDVQGKRHLSSSSSPVTQMDKRDSDD
SVFAPVTFKFGKNSLVPPVPPRLSKIYDDSTTPPIHPRKIGPPLPPRTLQVGFVFFQTSI
DSTELGINQDFNCKKNFVPVTSPSKIDLKTDTVNFPESDDTLEPYHHSLNVYLYNTLDYY
KNCCTKKKDS
NT seq 3633 nt NT seq  +upstreamnt  +downstreamnt
atggcctccaaatcgtttcccaaagcggaaatcgaaaaatttctgtgtatacaaactaat
ccaacgaaatggaaggggctgttgatcggatcgttaacgaaaatcgtcgatcaagttcac
ccattgttagcagtcagcgacgaagcattagcatgtgtcgaaatgctaattgtacaatgt
ctggagatactcacgttaaggtcatcaccaccgtacactagatttgacatcgaagatcaa
gtgaaacgatggtttcctaagccaatagacaagtgggctattaaagatgcaaatgaggca
atagaaaaaaacaagaaaaaacaccatttaatattaccaaccgataaaattcataattta
gtgcaaaaagaactaatccaatacaagttagactatacagtggctctttacataacagct
gttttagaatacatggcagcagacattttaaaattagctggtaattatgtaaataatata
caccatgtagaaatcagttatcaagacctatgtgttgcgatatgtggtgataaagtatta
atggacttgtttagccagcatgacaacaatggtgatttgaatctgtctgaattaagtatt
gataaaatccagagaatcactacttatgaagaagtcataaaagatctgatgcatgatgaa
aaacaactagttagagatttatatttaattttaaaagtgttcaaagaagaaatcaatcgt
gccattcccgtaggtacctgtcaagaactggataatatgtttgacaatattgcagaaata
tgtaagactactaaattatttttaagttctattgaagatatattggaaatttcagatgat
aaatttactaccattggttgttgtattgaagagtttgctgaaaccgctgaatttgacgtg
tttgaattatatgcaaatgatattgttaataaacaatgtagaaatatattttggaattta
atcagtaaaccagaagtttctaattcacttcaatcgactggttttaaagaagctctaaaa
tattattttccaaaattgttacttttacccatatggcattgtattctctattttgattat
tttagaattttgcatcaactttctccttcccgacatgataaagaatgtttggaacaagca
gaaggcatgtttaaacctttgcaattaaaaatgatatcaattgcaaaccaaattaactta
aaagataatgtcaaagaatttggacttaaaattaatgcaacaccaagacgattgttagcc
attgaaaaactgcaaaaaatgcaaaaatctattgatggctgggatggtaaagatatgggt
cagtgttgtacagagttcataagagaaggaatacttttaaaagtttcaagtggaggtaaa
cgttgttcagagcgtaaagcaatcttatttgatggtgtacttattttatgtaaatcaaat
agcaaaaagacttctgcattagtcagctctcaacttgttggtaacttgtctgaattcaaa
ttcaaattaaaagaaaaattattcattagaaaagtggacatttttgatagagacgataca
gatgagacaaaacacatttttgaaatattccctcgtttagagccaccaataacattagtt
gctaggacttttgaagataaagctaactggatggctgacttacttatgctgacctcaaaa
agtatactagacagaactttaaacaatatactactagatgaagataaaaaatttccctta
tggttaccttcagttgaagaatacagatttgttgaacctgattctcgatctaacataatt
tttgaggaaaaagaaaataatggtattcctcttattaaaggtgctatattactgaagcta
atagaacgattgacatatcatatttatgctgatccaaaatttgttaaaacatttttaaca
atatatcgcagtttttgttcacctcatgatttaatggatctcctaatcgaaaggtacaag
attcctgagccttctggtataactctgaattcagaaagtcttcgagatgaaactaagcga
tttaaaaaagaatatttaatacctgttcaatttagagtgttaaatgtgtttaggcattgg
gtcgactatcactattatgattatcaatgctatccatatttattagataaattgtacgag
tttttagattcaattaacggaaagtcaatcaaaaaattgacggattcacttattaaaata
attcatagaaaaacttctgaagctcaaaaagaaattacgtttgcatttgattcaccacca
ccagcaattgaagttcatatggattttaatggaaatgacaagtttaatattctacttgta
catcctcttgagtttgcaagacagttaacacttattgaatctgaaaattatagagcagtt
aaaccttcagagttggttggatctgtgtggactaaaaaggataaagaaataaattctcca
aatttacttcggttaatcaaacgtactacaaattttagtcgttggattgaaaaaactgtt
gtggaatgtgaaaatattgaagagagagtagcaactgtctctagatttattgaagtaatg
atggcactatatcaactaaataatttcaatggtgtcttaggtgttttttcagctatgagt
tcggctgcagtatttcgcctaaaatttacaatgcaatctctcaatgctaaacttgataaa
gggctagaagaagctcggaatttaagtattaatcattttaaaaaatatcaagataaatta
agaagtataaatccaccatgtgttccattcattggtatgtatttaacaaatatattgcat
attgaagaaggtaatccagattgtttgacaaacaacccaaatttaattaattttaataaa
cgaagaaaagtggcagaaattattgaagaaatccagcaatatcaaaatcaaccttactgt
ttaaatgtcgagcctaaaataaaaaagtttttagagaacttaaatccattcaatgatatg
aaagatacagatattaataactatttgtatagtaaatctttagaaattgaaccaagaaat
tgcaaacaacttcctaagtatccacgaaaatggccagacttaaatcttaagtcacctggc
ttaaagcctaaatcacgagtaccatcagtatcctccaaagaaatggatgtccaaggtaaa
agacatttaagttcatcaagttctccagttactcaaatggataaaagagattcagatgat
tctgtctttgcaccggtaacatttaagtttggaaaaaatagccttgttcctccagttcca
cctcgactgagtaaaatatatgatgattcaaccacaccacctatacatccaaggaaaata
ggtccacctttacctccaagaacattacaagtaggttttgtattttttcagacttctata
gactcaaccgaactaggaattaaccaagatttcaattgtaagaaaaactttgtaccagta
actagtcctagtaaaatagatctgaaaacagatacagttaattttcctgaaagtgatgat
actttagaaccttaccaccattctttaaatgtatatttgtataatactctagattactat
aaaaactgttgtactaaaaaaaaggactcataa

DBGET integrated database retrieval system