KEGG   Acyrthosiphon pisum (pea aphid): 100159829Help
Entry
100159829         CDS       T01076                                 

Definition
ubiquitin carboxyl-terminal hydrolase 5-like
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
api  Acyrthosiphon pisum (pea aphid)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 813 aa AA seqDB search
MDSDFALAAKQTLENCEANVPRDHDRVYKDECLYSFDSPDFEGGLFICLKTFAGFGYDHV
ERHHRKTGCSVFLHMLRHKIEVETKMTQVGDAPTERKVTRLAIGVDGGFDPDAENKKYKT
IEEYSIVILPSFKSFPFETSELPQKVIDSIKGIIEAKSANYLDELQSMSSTWDGEVRQKT
GYADIEQLNNGKIITPSGWKCEYDDCDKVDNLWLNLTDGSIFCGRKFFDGSGGNGHATLH
YEKTKYPLAVKLGTITKDGKGDVYSYPEDDMVENPNLVKHLSHFGINISALEKTEKSMVE
LELALNQKVGEWATLQESGSDLKPIFGPGYTGIHNLGNSCYMNSIIQVLFSIPDFTHKYY
LGSKEIFEMCQTNPTENFDVQMAKLAHGLCSGKYSTPPTEVVEGKKYWHHGIRPTTFKSL
IGKGHPEFATKKQQDAQEFFLYFLSMIGRYCQRSQNPVECFKFSIEERFQCSTTGEVDYS
YRPEYCLPLSISLDDIVNKAEVEAFKQKQAENDNKDVSEVVRPKLKFASCLNSFAQPEVI
EEFFNTTLNQRTTAEKITRFATFPDYLMIHLKKFTLRQDWTPIKLDVSVEMPEDMDIEYL
RGHGAQEGENLMAETIEPPPVYVYDENIMSELTNMGFPPEACKRAMYFTRNKSLNDATNW
LMEHISDHDFSEPFELPGTKINSEFLPNEEAAAMIMSMGFERNHVIAALKATENNLDRAL
DWIMSHGPEEILPAEETATNTICKPRDGKGIYKLFAFISHMGSSSTVGHYVCHIKKEGRW
VIFNDEKVAVSQNPPTDLGYLYVYKRMSNDQVM
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atggacagcgattttgctttagctgctaagcaaacattagaaaactgtgaagcaaacgtt
ccccgagatcacgatcgtgtctataaagacgaatgtctttattcatttgattctccagat
tttgagggtggcctttttatttgcttaaaaacatttgctgggtttgggtatgatcatgtt
gaacgtcatcatagaaaaactggatgttcagtgtttttacatatgcttcgacacaaaata
gaggttgaaaccaaaatgacacaggtaggtgatgctccaactgaacggaaagttactaga
cttgctattggcgtagatggtggatttgatccagatgctgaaaataaaaagtataaaaca
atagaagaatattctatagttatattaccatcatttaaatcctttccatttgaaactagt
gaattaccacagaaagttattgattctataaaaggtattattgaagctaaatctgctaat
tatttagatgaattacaaagtatgtctagcacttgggatggtgaagttcgacaaaaaact
ggatatgctgatatagaacagttaaataatgggaaaataattactcccagtggttggaag
tgtgaatatgatgattgtgataaagtcgataatctatggcttaatttgactgatggttca
attttttgtggtcgaaagttttttgatggatctgggggaaatggacatgctactcttcat
tatgaaaaaactaaatatcctttggctgttaaacttggtactattacaaaagatggtaaa
ggagatgtatacagttatccagaagatgatatggtagaaaatccaaatttagtcaaacat
ctttcacattttggtattaatatttctgctttggaaaagactgaaaaatcaatggtagaa
ttagaattagctttaaaccaaaaggttggtgaatgggcaacattacaagagagtggaagt
gatttaaaaccaatttttggtcctggttacacaggtattcacaatttgggaaattcttgt
tacatgaatagtatcatacaagttttattttctataccggattttacccataagtactat
ttaggttcaaaagaaatatttgaaatgtgccaaaccaaccccactgaaaatttcgacgta
caaatggcaaaattagcccatggtctatgttcaggaaaatattcaacgccacctacagaa
gttgttgaaggaaaaaaatattggcatcatggtattagaccaactacttttaaatcgttg
atcggcaaaggacatcccgagtttgctacaaagaaacagcaagatgcacaagaatttttt
ttgtatttcttgtcaatgattgggcgctattgtcaacgttctcaaaacccagtcgaatgt
ttcaaatttagtattgaagaacgttttcaatgttcaactacaggagaagttgattacagc
tatagaccagaatactgtttgccattgtccatttcacttgacgatattgttaacaaagct
gaagtcgaagcttttaagcaaaaacaagctgaaaacgataataaagacgtaagtgaagta
gttcggccaaaattgaaatttgcatcttgtttaaattcttttgcccagccagaagtcatt
gaagaattcttcaatactacattgaaccagagaactactgcagaaaagattacaagattt
gctacatttcctgattacctcatgatacatttaaaaaaatttacacttcgtcaagattgg
actcctattaagttggatgtatctgttgaaatgcctgaggatatggacatagaatatcta
agaggacatggtgcacaagagggggaaaaccttatggcagaaactatagaacctccacca
gtgtatgtgtacgatgaaaatattatgtctgaattaacaaatatgggatttcctccagaa
gcatgcaagcgtgcaatgtatttcacaagaaataaaagtctcaacgatgctacaaattgg
cttatggaacatatatcagatcatgatttctcagaaccctttgaactaccagggacgaaa
attaattcagaatttttgcctaatgaagaagcagctgctatgataatgtcaatgggtttt
gaacgaaaccatgtaattgctgctttgaaagccactgaaaacaatctagatcgtgctctt
gactggataatgagtcatggaccagaagagatactcccagcggaagaaacagcaacaaat
acaatttgtaaacctagagatggaaaaggaatatataagttgtttgcatttatatctcac
atgggcagttcttccacggttggacattatgtttgccatataaaaaaggaaggacgttgg
gtaatattcaatgatgaaaaagtagcagtttctcaaaatcccccaactgatttaggttac
ttatatgtttataaaagaatgtctaatgatcaggttatgtga

DBGET integrated database retrieval system