KEGG   Acyrthosiphon pisum (pea aphid): 100159998Help
Entry
100159998         CDS       T01076                                 

Definition
ubiquitin carboxyl-terminal hydrolase 5-like
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100159998
Peptidases [BR:api01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100159998
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100159998
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 811 aa AA seqDB search
MERYFALAVKQILENCEANVPRDHDRVYKDECLYSFDSPDFQGGLFICLKTFAGFGYDHV
ERHHRKTRCSVFLHMLRYKIEVETKMTQVGDAPTKRKVPRLAIGVDGGFDPDVENKKYKT
IEEHSIVILPSFRSFQFRTSGLPQKVIDSIKGIIEAKSANYLDEIQSMSNTWDGKVRQKT
GYSDIEQLNNGKIITPSGLKCEYDDCDEVNNLWLNLTDGSIFCGQKFFDRSWGYGHATLH
YEETKYPLAVKLGTITKDGKGDVYSYPENDMVENPNLVKHLSHFGINISALEKTEKSKAE
LASNQKVGEWATLQESGSDLKPIFGPGYTGIHNLGNSCYMSCIIQVLFSIPDFTNKYYLG
SKDIFEMCQTNPTENFDVQMAKVAHGLCSGKYSTPPTEVVEGKNYWHRGIRPITFKSLIG
KGHPEFATKKQQDAQEFFLYFLSMIGHYSKHSQNPVECFKFSIEERFQCSITGEVDYSYR
PVYCLPLSILLDDIVNKAEVKAFKQKQAENDNKDVSEVVRPKLKFASCLNSFAQPEVYEE
FFNTTLDRTTTAEKITRFATFPDYLMIHLKKFTLHQDWSPIKLDVSVEMPEDMDLEYLRG
HGAQEWENLMVETIEPSPMFVYNENIFSELTNMGFPPEACKRAMYITRNKSLNDATNWLI
EHTSDHDFSEPFELPETKINSEFLPNEEAAATIMSMGFERNHVIAALKATENNLDCALDW
IISHGPEEILPTEETATSKIYKRRDGKGIYKLFAFISHMGSSSTVGHYVCHIKKEKRWVI
FNDEKVAISQNPPTDLGYLYVYKRMSNDQVM
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atggaaagatactttgctttagctgttaagcaaatattagaaaactgtgaagcaaacgtt
ccccgagatcacgatcgtgtttataaagacgaatgtctttattcatttgattctccagat
tttcagggtggcctttttatttgtttaaaaacatttgctgggtttgggtatgatcatgtt
gaacgtcatcacagaaaaactagatgttcagtgtttttacatatgcttcgatacaaaata
gaggttgaaaccaaaatgacacaggtaggcgatgctccaactaaacggaaagttcctaga
cttgctattggcgtagatggtggatttgatccagatgttgaaaataaaaagtataaaaca
atagaagaacattctatagttatattaccatcgtttagatcctttcaatttagaactagt
ggattaccacagaaagtcattgattctataaaaggtattattgaagctaaatctgctaat
tatttagatgaaatacaaagtatgtctaacacttgggatggtaaagttcgacaaaaaact
ggatattctgatatagaacagttgaataacggaaaaataattactcccagtggtttgaag
tgtgaatatgatgattgtgatgaagtcaataatctatggcttaatttgactgatggttca
attttttgtggtcaaaagtttttcgatagatcttggggatatggacatgctactcttcat
tatgaagaaactaaatatcctttggctgttaaacttggtactattacaaaagatggtaaa
ggagatgtatatagttatccagaaaatgatatggtagaaaatccaaatttagtcaaacat
ctctcacattttggtatcaatatttctgctttggaaaagactgaaaaatcaaaggcagaa
ttagcttcaaaccaaaaggttggtgaatgggcaacattacaagaaagtggaagtgattta
aaaccaatttttggtcctggttacacaggtattcacaatttgggaaattcttgttacatg
agttgtatcatacaagttttattttctattccggattttacgaataagtactatttaggc
tcaaaagatatatttgaaatgtgccaaaccaaccccactgaaaattttgatgtacaaatg
gcaaaagtagcccatggtctatgttcaggaaaatattcaacgcctcctacagaagttgtt
gaaggaaaaaattattggcatcgtggtattagaccaattacttttaaatcgttgatcggc
aaaggacatcccgagtttgctacaaaaaaacagcaagatgcacaagaattttttttgtat
ttcttgtcaatgatagggcattatagtaaacattctcaaaacccagtcgaatgtttcaaa
tttagtattgaagaacgttttcaatgttcaattacaggagaagttgattacagctataga
ccagtatactgtttgccattgtccattttacttgacgatattgttaacaaagctgaagtc
aaagcttttaagcaaaaacaagctgaaaacgataataaagatgtgagtgaagtagttcgc
ccaaaattgaaatttgcctcttgtttaaattcttttgcccagccagaagtctatgaagaa
ttcttcaatactacattggaccggaccactactgcagaaaagattacaagatttgctaca
tttcctgattacctcatgatacatttaaaaaaatttacacttcatcaagattggtctcct
attaagttggatgtatctgttgaaatgcctgaggatatggacctagaatatctaagaggg
catggtgcacaagagtgggaaaaccttatggtagaaactatagaaccttcaccaatgttt
gtgtacaatgaaaatattttttctgaattaacaaatatgggatttcctccagaagcatgc
aagcgtgcaatgtatatcacaagaaataaaagtctcaatgatgctacaaattggcttata
gaacatacatcagatcatgatttctcagaaccctttgaactaccagaaacgaaaattaat
tcagaatttttgcctaatgaggaagcagctgctacgataatgtcaatgggttttgaacga
aaccatgtaattgctgctttgaaagccactgaaaacaatttagattgtgctcttgactgg
ataattagtcatggaccagaagagatattaccaacggaagaaacagcaacaagtaaaatt
tataaacgcagagatggaaaaggaatttataagttgtttgcatttatatctcacatgggc
agttcttccacagttggacattatgtttgccatataaaaaaggaaaaacgttgggtaata
ttcaatgatgaaaaagtagcaatttctcaaaatcccccaactgacttaggttacttatat
gtttataaaagaatgtctaatgatcaggttatgtga

DBGET integrated database retrieval system