KEGG   Acyrthosiphon pisum (pea aphid): 100160001Help
Entry
100160001         CDS       T01076                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  KO
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Longevity regulating pathway - multiple species
AGE-RAGE signaling pathway in diabetic complications
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100160001
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100160001
   04070 Phosphatidylinositol signaling system
    100160001
   04150 mTOR signaling pathway
    100160001
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    100160001
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100160001
Enzymes [BR:api01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100160001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
APHIDBASE: 
UniProt: 
Position
Un
AA seq 1067 aa AA seqDB search
MVCENPAFNFNFWNEINHDSVVEVTCLMPNSISIPLTVSTSTSLHELKEELWEEAVKYPL
HGMLHDSSSYSISYVNAMAQREMLVDENKRLCDVRPFLAVLNIVERQEDKADNVLNAQIS
NLIGKGLMEFDSLKSSEVNQFRGKMKALADQMQANRRRQSWLERLLYQFAPRLAASTLSS
NVLPTTVTRRLRDDNFSVVIKFDSTETTFTFNVGLTTTPDQLMMQILNKRAMTLKTRNEK
CSDFTLKVCGREEYIVGLHPLIDFAYIQDSLSQDLNPILIAVSKFNVPVPEEVNKDQTEY
IEQNKTRTTLTLRKKTKHKLSFDIDEQFKFKVNYISKLNCDVTRTVEVGIEAALFHGGKA
LCECVRTSEKIVNNGDCTWDEELEFDMSIADIPRMARLCLVVYEVSKTSKGLRTRRIKES
KQEMFVTPMDWVNTTVYDFKNQLKSGSITLYMWTYADDLQNEDLLHPLGTVVSNPNVEQT
TALTITFHSYQPAEHVIVYPSLDKLREYADKKGKDDLKDQAVGDSQSLKTYLDQIKTMAE
RGEPLDEMHEQDRKKLWRHRYHILQSVPGLLAKLLDCVEWGIRWEVAEATSLVSRWPLLG
PQQALELLDYAYADQVVRSFAVKCLQILSDEDLSLFLLQLVQALKHESYLCCDLVEFLLT
RALQNQKIGHYLFWHLRSEMQVASVSVRFGLMLEAYCRGSIEHMKTLIRQMDFLEKLKKT
TELVRQRRDKEKARSFLQEYFQEGHCIEAMSSVHSPLDPSYKCKRVRTEKCRVMDSKMKP
LWIVFENVDSHGDDIYVIFKNGDDLRQDMLALQMIRIMDKLWKNEGLDLRMNPYQCISTD
NRVGMIEVVLNAETIANIQKEKGMFSATSAFKKGSLLAWLKDYNQTEQSLQKAIEEFTFS
CAGYCVATYVLGVADRHSDNIMVKKTGQLFHIDFGHILGHFKEKFGFRRERVPFVLTHDF
VHVINKGQTRKEALEFQMFQNYCEKAFLILRRHGSLILSLFAMMISTGLPELGSEKDLNY
LRETLVMDLSENDAKMHFRSKFEEALGNSWKTSLNWASHNLAKNNKQ
NT seq 3204 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgcgaaaatccggcttttaatttcaatttttggaatgagatcaaccatgattct
gttgtagaagtcacttgtttaatgcccaatagtatttcaataccattaacagtttcaacg
agcacatctttgcacgagttaaaagaggaattatgggaagaggcagtcaaatatcccttg
cacggtatgttgcacgactcaagcagttacagtatatcttatgtcaatgctatggcccaa
cgagaaatgcttgtggacgagaataagagactgtgtgatgtacgaccatttttagcagtc
ctcaacattgtagaacgtcaagaagataaagcagacaatgtacttaatgcccaaataagt
aatcttattgggaaaggtctaatggaatttgattcattgaaaagttcagaagtaaatcag
tttcgtggaaaaatgaaagcattagctgatcaaatgcaagctaatcgaagacgacaaagt
tggttagaacgacttttgtatcaatttgcaccacgcttagcagcttctactttatcttct
aatgtcttgcctactacagtaacaaggaggctaagagatgataatttttcagttgtaata
aaatttgatagcacggagactacatttacatttaatgtgggtcttacaacgacacctgat
caactgatgatgcaaatactaaataaacgtgcaatgacattaaaaactagaaatgaaaag
tgttcggattttactctaaaagtttgtggccgagaagaatacattgttggtttacatcct
ttaatagattttgcctatatacaagatagtctgtctcaagatctcaacccaattttgatt
gctgtttccaagtttaatgttccagttccagaagaagttaacaaagaccagactgaatac
attgagcaaaataagactcgtactacattaacattacgtaaaaagactaaacacaaattg
tcatttgatattgacgaacaatttaagttcaaagtgaactatattagtaaattaaactgt
gatgttaccagaactgttgaagttggaatcgaagcggctttgtttcacgggggtaaagcg
ttgtgcgagtgtgttaggacgtctgaaaagattgttaacaacggtgactgtacatgggac
gaagaactagaatttgacatgagtatagctgacataccacggatggctcgtttatgttta
gtagtatatgaagtctccaaaacatcaaaaggactaagaactagacgcattaaagaatcc
aaacaagaaatgtttgtaacaccaatggactgggtcaacacaactgtgtatgactttaaa
aatcagctaaaaagtgggtcaattacgctgtatatgtggacatatgctgatgatttgcaa
aatgaagacttgttacacccgcttggtactgttgtgtctaatccaaatgttgaacaaaca
acagcattaactataacttttcatagttatcaaccagctgagcacgtaattgtgtatcca
agtttggataaattacgagagtatgctgataaaaaagggaaagatgacttaaaagatcaa
gcggttggagattcacaatcactaaaaacttatttagatcaaataaagacaatggccgag
cgtggggaacctttagatgaaatgcatgaacaggatcgaaagaaactgtggcggcatagg
tatcatatattgcaatcagtgcctggacttttagctaaacttttagattgtgtggaatgg
ggtatacggtgggaagtagctgaagctacctcattggtctccaggtggcctcttttagga
ccacagcaagctttggaattgctagactatgcttatgctgaccaagtagttcgaagtttt
gccgttaaatgcttacaaatactaagtgatgaagatctttcattgtttcttttacaactg
gtccaagctctgaaacatgaatcttatttatgctgtgacttagtagaatttttgcttaca
agagcattacaaaatcaaaaaattggccattacttattttggcatctcagatcagaaatg
caagtggcgtctgtgtcagtgcgcttcggtttaatgttggaggcatattgccgaggatcc
attgaacacatgaaaacattaataagacaaatggattttttggaaaaactgaaaaagacc
acagagttagttaggcagcgtcgcgacaaagaaaaagctcggtcttttttacaagaatat
tttcaagaaggacattgcatagaagctatgtcatctgtgcatagtcctttagatcccagt
tataagtgcaaaagagttagaactgaaaagtgtcgcgtgatggatagtaaaatgaaacct
ttatggatagtttttgaaaatgttgattcacatggcgatgacatttacgttatatttaaa
aatggtgacgatttaaggcaggatatgcttgctttacagatgatacgtattatggacaaa
ctatggaaaaatgaagggttggatttgaggatgaatccatatcaatgtatatcgacagat
aaccgtgtgggtatgattgaagtggtattgaatgcagagaccatagctaatattcaaaaa
gaaaaaggaatgttttcagcaacatctgcttttaaaaaaggatcgttattagcatggtta
aaagactacaatcaaacagaacagtcattgcaaaaagccattgaagaatttaccttttca
tgtgctggctattgtgtggcaacctatgtactgggtgttgctgatcgccattccgacaat
attatggtcaaaaaaacaggccaactgtttcacattgattttggtcacattcttggtcat
ttcaaagagaaatttggtttccgccgtgaacgtgtaccatttgtgttgacccacgacttt
gtgcatgttattaataaaggccagactagaaaagaggccctcgaattccaaatgttccag
aattactgtgaaaaggcctttctaatattaaggagacatggctcattaatactttctctt
tttgcaatgatgatttcaactggtctgcctgaattgggttccgaaaaagatctcaattat
ttacgtgagacacttgtaatggacctatcagaaaatgatgctaaaatgcatttccgatcc
aagtttgaagaagcattaggcaattcgtggaagacatcacttaattgggcatctcataat
ttagcgaaaaacaacaaacaatga

DBGET integrated database retrieval system