KEGG   Acyrthosiphon pisum (pea aphid): 100160041Help
Entry
100160041         CDS       T01076                                 

Definition
dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100160041
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100160041
   00020 Citrate cycle (TCA cycle)
    100160041
   00620 Pyruvate metabolism
    100160041
Enzymes [BR:api01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     100160041
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 492 aa AA seqDB search
MSGSNTIMNNVRLLRNLNRNTVRTVTTKCPIKVIQAYRCQSSIHWRSGRRPSVKNVGYRF
YATDFPSHIKVALPALSPTMESGTIINWTKKEGERLNEGDKLAEIETDKAIMDFETPEEG
YLAKIMVPAGQKDVTVGKLVCIIVENESDVAAFKDFVDNTSAGAPAPAAPSPSPKPSTSA
PAPPPPAPVAPKASAPTKSVPIPIGSRILASPLAKRLATEKGLDLSTIRQGSGLFGSIKS
TDLDKASITSSQKTAVADGIRGDGFVDKPVTNVRKIIAKRLLESKQTIPHYYLTVDLGLD
NIVSLRKRMNELLEKEGVKLSINDFIIKAAALACKKVPEANSSWMDNFIRQYDAVDVSVA
VSTETGLITPIVFNADTKGLIAISTDVKELAAKARQGKLQPQEYQGGTFSVSNLGMFGVK
SVSSIINPPQSCILGIGAMTQRLVPDKTNGTRAQDTLQVTLSCDHRVVDGAVGAQWLQAF
RRYVEEPHNMLL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgtctggatcaaacaccatcatgaacaacgtgcgtctgttacggaacctaaataggaat
acagtgagaacagttaccactaaatgtccaatcaaagttattcaagcatataggtgtcaa
agttccattcactggcgctctggtagacgtccttccgtaaaaaatgttggctatcgtttc
tatgccacagatttcccgagccatattaaagttgctctcccagctttgtctcctaccatg
gaaagtggcaccattattaattggactaaaaaagaaggtgaaagattaaacgaaggagac
aaactagctgaaattgaaacagataaagccattatggactttgaaactcctgaagaagga
tatcttgccaagatcatggtgcctgctggtcaaaaagatgttacagttggaaagctcgtg
tgtattatagtagaaaatgaatctgatgttgctgctttcaaagactttgtggacaatact
tcagcaggtgctcctgccccagcagcaccatcaccatcacccaaaccatctacttctgca
cctgccccgcctcctcccgcacctgtagctccaaaagcctcagcaccgacaaagtcagta
cctattccaattggatctcgtatacttgctagtcctttagcaaaacgcttagctaccgag
aaaggattggatttgagtacaataaggcaaggttctgggttgtttggttcaataaaatcg
acagatttggacaaagcttctataaccagtagtcagaaaactgctgtcgctgatggcatt
cgcggtgatggatttgttgataagccggtgacaaacgttcgaaagatcattgcgaaacgt
ctgcttgagtctaaacaaactataccacattattatcttacagtagatttgggtctggat
aatattgtttcattgagaaaacgtatgaatgaacttttggaaaaagaaggagttaaatta
tccataaatgatttcattattaaagcagcggctttagcttgtaaaaaagttccagaagcc
aactcttcttggatggataatttcattcgacaatatgacgcagttgatgtaagtgtggca
gtaagtactgaaacaggtctgataacgccaattgtattcaatgcagatactaaaggatta
atagcaataagcactgatgttaaagaacttgcagctaaagcccgtcaaggaaaactgcaa
cctcaagaatatcagggaggcacatttagtgtttcaaatttgggaatgtttggtgttaag
agcgtatcatcgataattaatcctcctcaatcgtgcatactcggcattggtgctatgact
caacgattagtaccagataagacaaatggaacccgtgcacaagatacactacaagttaca
ttaagttgcgatcacagagttgtagatggtgctgttggagctcaatggttacaagcattt
aggcgatatgtagaagaaccacataatatgctactttaa

DBGET integrated database retrieval system