KEGG   Acyrthosiphon pisum (pea aphid): 100160130Help
Entry
100160130         CDS       T01076                                 

Definition
uncharacterized LOC100160130
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100160130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 671 aa AA seqDB search
MTVKKKETGSSVNKSSTPPKSTARKDLASSTDSSTNSSSSSSSSTSGSDSTSSSDTENSS
TTENNSSESEKHKKSPKKKASTSSEPKVSELSKKQSSPDKFKNKTNTAPKLTAAIYTDSD
TDAETKTKRKFPPVKPKATATVAAVLKSQDKNKKSDVKRSQGPRSKATAITDGVKKPDSK
SKSIFSPDKINSSDSDPPPPKLTPMKSATTQKALVKPRPKAMAKLKKHSPTTKTSTLTSA
SSESSDTDSSLDKKIKKTTQEQHKKKLLNKTPQPATKVTSANESSSSGKVSRGRGRPRKY
PVPEPTKNGSNTNSNSKAGQDQKLVTTRGSTRVSRILAASHRTTTATDSDSDTGSKSTST
SCKSPTKKSRDKTRKPLNCNDKRLNSGGLVELEERLCPVNGCDSLGHLNGLYERHFTSEA
CPMYHRLTIKQCQENLSERLKKNEERLKGTLKSSSAEQKNYRDKVKEMRNDIDDKKKNET
SSDTSQSDQYAGKDLEPDILNCSNIPSYDIKLFQEAQAVASEKIEEDLKQLPNFKGTKYL
EMGKYEMEVWYQSPYPEEYTQVPKLYLCEFCLHYIKSKTVLFRHKLKCVWKHPPGDEVYR
KDRISVWEVDGKRFKIFCQNLCLLAKFFLDHKTLYYDVEPFLFYIMTTQDEDGCHIVGYF
SKVSLSLHYWI
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgactgtaaagaaaaaggagactggatcttcagtaaataagtcatcaacaccacctaaa
tctactgcacgaaaagatttagcttccagtacagattccagtacaaatagttctagtagt
tcatcatcatcaacatcaggatctgattccacaagttcatctgatactgaaaattcatct
accactgaaaataattcttctgaatcagaaaaacacaagaaatcaccaaagaaaaaagca
tccacttcttcagaaccaaaagtctctgaactttctaaaaaacaatcttcaccggacaaa
tttaaaaacaaaacaaatacagctcctaaattaacagctgctatctatactgattcagat
acagatgcagagacaaaaaccaaaagaaaatttccaccagtaaaacctaaagctactgca
acagttgcagcagttttaaaatcacaggataaaaacaaaaaatctgatgttaaacgtagt
caaggaccgaggtctaaagccacagctatcactgatggagttaagaaacctgactcaaag
tcaaaaagtattttcagcccagataagataaacagtagtgacagtgatcctccacctcca
aaacttacgccaatgaaaagtgctactacacaaaaagcattagtaaaacctagaccaaaa
gcaatggcaaaattaaaaaaacattcaccaactactaaaacatccaccttaacatcagca
agttctgagtcatcagatacagattcatcgttagataagaagattaaaaaaacaacacaa
gaacaacacaaaaaaaaacttttaaataaaacaccgcagcctgccacaaaagttacaagt
gctaacgaatcttcatctagtggtaaggtctctagaggacgtggccgacctagaaaatat
ccagttccagaaccaactaaaaatggttcaaatactaattccaactcaaaagccggtcag
gaccaaaaacttgttacaactagaggatctaccagagttagtcgtatattagctgctagc
catagaactacgactgcaacagattctgattcagatacaggaagtaaatcaactagtacc
agttgcaaatcacctactaaaaaatctcgtgacaaaacacgcaagccactaaattgtaat
gataagagattgaatagtggagggcttgttgaattagaagaaagactttgtccagttaat
ggttgtgattcattaggtcatctaaatggcttatatgagcgtcattttacttcagaagcc
tgccccatgtatcatagattaactataaaacaatgtcaagaaaatttatctgaacgacta
aagaaaaatgaagaacgtttaaagggtacattaaaatctagttcagccgaacaaaagaac
tatcgagataaagttaaagaaatgagaaatgatatcgatgataaaaaaaaaaatgaaaca
agtagtgatacttcgcaaagtgaccaatatgctggtaaagatttagagcctgatatactc
aactgctctaatataccatcctatgatattaagttatttcaagaagcacaagcagtagcc
agtgagaaaattgaagaagatttaaaacaattaccaaattttaaaggcacaaagtattta
gaaatgggaaagtatgaaatggaagtttggtatcaaagtccatacccagaagaatataca
caggtaccaaagttgtacttatgtgaattctgtttacactacattaaaagcaaaacagta
ctatttagacataaactcaaatgtgtttggaaacatccacctggcgatgaagtttatcgg
aaagaccgtatatctgtttgggaagtagatggtaaacgattcaaaatattctgccaaaat
ttgtgtttacttgcaaaattctttctagaccataaaacactttattatgatgtagaacca
tttttgttttacataatgactactcaggacgaagatggatgtcatattgttggttatttc
agtaaggtaagtttatctctacactattggatttaa

DBGET integrated database retrieval system