KEGG   Acyrthosiphon pisum (pea aphid): 100160142Help
Entry
100160142         CDS       T01076                                 

Definition
UDP-glucuronosyltransferase 1-7-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100160142
   00053 Ascorbate and aldarate metabolism
    100160142
   00500 Starch and sucrose metabolism
    100160142
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100160142
   00860 Porphyrin and chlorophyll metabolism
    100160142
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100160142
   00982 Drug metabolism - cytochrome P450
    100160142
   00983 Drug metabolism - other enzymes
    100160142
Enzymes [BR:api01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100160142
Glycosyltransferases [BR:api01003]
 Others
  Hydrophobic molecule
   100160142
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 518 aa AA seqDB search
MKYIMILVILLYFYVHAIKSSNILVFVPSPWKSHITSFQPLFLELANRGHNVTVVSKFIV
KNPPPTYTQLIPSYDFDIDGRSDFLMRERSIHYSFFEDPITRSTVLVDTTYMFLSDPEVQ
KFIKYDQSTFDLVIIESFFQECTVALGHKYRAPVISIVPVTPWVSVSRWTANPSDFSYIK
DFMLDGGKSMTFWERFTNSYIGFYCLFVELITYLPKLENIMDTYFQYPGYENRPTMSEML
KNISLSLIDSDVTLFSPRPYIPSFIEVSGIHIRPKKQMDERLQDFMDKANTGVVYFNFGT
ILNVTSIPKSSMRSLINVLGRLEQKIVFRWINNDTQGFPRNFYVNSWLPQREILNHPNCK
LFITHGGVHGIIETIDAGIPIIGFPVFGDQFQNVRSSQENGIGIMSNIFTMTEETFEKDI
KLIINEKKFSENVKRMSSIFHDRPMSALNTAVYWVEYVIRNKGAHHLRSAAVDLTWYQYY
LLDVIAFLIIISLFFICIFYFITKRIMRFNIFTKQKTD
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacattatgatattggtaattttattatacttttatgttcatgcaataaaaagt
tcaaatatacttgtatttgtgccatcgccatggaaaagtcacattacttcttttcaacca
ttattcttggaattagcaaatcgtggtcataatgtaacagtagtatcaaaatttatagtt
aaaaatccaccaccgacatatacacaattgattccttcttacgattttgatattgatgga
agatcagatttcttaatgcgtgaacggagcattcattattcatttttcgaagatccaata
acacgtagcacagtattagtcgacacaacatatatgtttttatcagatccagaagtacag
aaatttattaaatatgatcaatcaacgtttgatttagtcatcatagaatcattctttcaa
gagtgcactgtagcgctgggccataaatacagagcaccagtaatttcaatcgttcccgta
actccttgggtaagcgtatctcgatggacagcaaatccttcagatttttcatacattaaa
gactttatgctggatgggggcaagtcaatgactttttgggaacgattcacaaatagctat
attgggttttactgtctatttgtcgaactcattacgtatcttccaaaattggaaaatata
atggatacctacttccaataccctggatatgaaaaccgacctacaatgtcggagatgctg
aagaacatatcgctcagtttaattgactctgatgtaacactttttagtccacgaccatat
attccgagttttattgaagtttctggtatccatattcgacctaaaaagcaaatggacgag
agactacaagactttatggacaaagctaatacgggtgttgtctatttcaattttggcact
atattgaatgtgacaagtataccgaagtcgtctatgcgcagtttgattaatgtattaggc
cgattagaacagaagattgtctttagatggatcaataacgacactcaaggattcccaaga
aacttttatgtcaactcttggctcccgcaaagagaaatactgaatcatccaaattgcaaa
ctttttatcactcatggaggagtccatggtattatagagacaatagatgccgggattcca
attattgggtttcctgtttttggggatcagtttcaaaatgtaagaagcagtcaagaaaat
gggattggtattatgagtaatatttttacgatgactgaagaaacatttgaaaaagatata
aaactaataatcaatgaaaagaagttttctgaaaatgttaaaagaatgtcttccatattt
catgatcgaccgatgtcagctctgaatactgcggtatattgggtggaatacgtaatcaga
aataaaggagctcatcatttacgttctgcagcagtggatttaacgtggtaccaatattat
ttattagacgttattgcatttcttataataatttcattgttttttatttgtattttctat
tttattactaaacggattatgagatttaatattttcactaaacagaaaacagattaa

DBGET integrated database retrieval system