KEGG   Acyrthosiphon pisum (pea aphid): 100160238Help
Entry
100160238         CDS       T01076                                 

Definition
uncharacterized LOC100160238
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
api  Acyrthosiphon pisum (pea aphid)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 922 aa AA seqDB search
MDNSATQEFEFLDFTDINDMERGRLLQMLYSARNESWVSGEDGFKHPDFPWTFRGTQPQA
LPPSGLMNEVGNITHISDWNTAADEYVNGDAEPENPVMINGGNFVPGPPPPVYQMVPNPP
VYMGNVPPPVHGYVPSQMSPYQQPMYPGPEPPMDPNLRRPNISRNPKGIPPPPNVKRNNE
IAYRHPDNMEMANYQSPPTYIAVPPPHHYYYSPQNSPLYLPPHHGHPTYPVYTHPHPTLY
NPYQQPGPPMYHSPPAGQVPQQPLLVESCKPNVNPIPPVHNIYPEVPENVNETSVEPEIM
SIPQDKEVELQVQPECVEVIEIIPEVTRDERLVIVSEVPIVVETIPLVESCEKIKEPLPN
KTKKKKEPVPNIPSDVVQEIQQPEKEETKTEDVTPVVEFKEETPLNQEQASSSSIPPVVI
PEVKDTEPAKPVFKTWAGLFTGCASTSNDKVFTLHGSSQPTTNPNTESIIMPSRNLPDTT
IRTSVFVTNNNQKQTLPVKPRPSSSSSISSVDDNSLNLQRLGEFLSVYNLDHKTAHLQPR
GLTNRNTRCYINATLQALLTCPPFFNLMRSVQFKLKNRNNRGPQKSQTPILESMVQFIGE
FQQLSIKNGRTTQQQRQATSVATQETPDTGPAFEPSYVYKILPAFEEGRQEDAEEFMSYL
LNGINDEMIELIKMSKSNISNGETQAEVDAIDNNNEWKEVNGKHKMVTRRTVMEKTPLSE
IFRGQLRTRTVKNGENEPTENIEPFFTLKLDIEKAKSVREALDMLVNKDTLEGLTCPKTN
RELDAYQQVTIDELPYVLLLHLKCFEYKQQKLTKIVKNVEFSVDLKIEPRLISKNSKINM
KTRQYKLFAVVYHDGKEANKGHYFADVFYVALGRWLRFDDASVRFVTDKEVCQPKPPCMP
YLLYYRRNDTIAALSAFDNKGR
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atggacaacagtgcgacccaggagtttgagttccttgatttcacagacatcaatgacatg
gaacgtggccgattgctgcaaatgctgtattctgcacggaacgagtcatgggtgtctgga
gaagatggattcaaacatcctgattttccatggacttttcgcggtactcaacctcaggca
cttcctccgtcaggtttaatgaatgaagttggaaacatcacacatatttctgattggaat
acagcagcagatgaatatgttaatggtgatgcagaacctgagaaccctgtgatgataaat
ggtggaaattttgttcctggtcctccaccaccagtttatcaaatggtgccaaatcctcca
gtgtatatgggtaacgtacctccaccagtgcatggatatgtaccatctcaaatgtcgcca
tatcaacaaccaatgtatcctggaccagaaccccctatggaccccaatcttaggcgccca
aacatttccaggaatccaaaagggattcctcctccgccaaatgtgaaacggaataatgaa
atagcttatcgacatccagataatatggaaatggccaattatcaatcaccaccaacatat
attgctgtccctcctccacatcattattattattcacctcaaaatagtccattatacttg
cctcctcatcatggacatccaacatatcctgtgtacactcatccacatcctactttatac
aatccataccaacaacctggtcctcctatgtaccattcaccaccagctggtcaagtacct
caacaacctcttttagttgaatcatgcaaacctaatgttaatccaattccaccagtgcat
aatatttatcctgaagtaccagaaaatgttaatgagacttcagtggaaccagaaataatg
tcaataccacaggataaagaagtagagttacaagtacaaccagaatgtgtggaagttatt
gaaattataccagaggtaacaagagatgagcgattagttattgtgagtgaagtgcctatt
gttgtagaaacaattccattggttgagtcttgtgaaaaaatcaaagaaccattacctaat
aaaacaaaaaaaaagaaagaacctgtccctaatatcccttcagatgtggtacaagaaatc
caacagcccgagaaggaagaaactaaaaccgaagatgtaactcctgttgtagaattcaaa
gaagaaactcccttaaatcaagaacaggcttcttcatcttctatccctcccgtagttata
cctgaagttaaagacactgaacctgctaaacctgtttttaaaacatgggcaggactattt
actggatgtgctagtacaagtaatgataaagttttcacactacatggtagtagtcaacca
actaccaaccccaatacagaatctataattatgccatcaagaaatttacctgatactaca
attcggacatcagtttttgtaaccaataataaccaaaaacaaacattaccagttaaacct
agaccatcaagcagcagctctatatctagtgttgatgataatagcttaaatttacaaaga
ttaggtgaatttctttcagtttataatttggaccataaaactgctcatctacagcctaga
ggtttgaccaatcgtaacactcgttgttatataaatgccacattgcaggctttgttaaca
tgtcctccttttttcaacctcatgagaagtgtgcaatttaaactcaaaaatagaaacaat
cgaggaccccaaaaatcccaaaccccaattctagaaagcatggttcaattcattggagaa
tttcaacaattaagcattaaaaatggtagaactactcaacagcaacgtcaagctacgtct
gtggctactcaagaaacgcctgatactggtccagcatttgaaccaagttatgtttataaa
atactaccagcttttgaagaaggccgccaagaagatgcagaagagtttatgagttatctt
cttaatggaattaacgatgaaatgattgaactaattaaaatgagcaaatctaacataagc
aatggtgaaacacaagctgaagtagatgctatcgataataacaatgaatggaaggaagtt
aatggtaaacataaaatggtgaccagaagaacagttatggaaaaaactccattatctgag
atattccgtgggcagctacgtactcgcacagtgaaaaatggtgaaaatgaaccgactgaa
aatattgaacctttcttcacacttaagctagacattgagaaagcaaaatctgttcgggaa
gctttggacatgctagtcaataaagacacactcgaaggattaacttgtccgaaaaccaac
cgtgagctagatgcgtaccaacaagttactattgatgagctaccttatgtcttactattg
catcttaaatgttttgaatacaagcaacaaaaactgacaaaaattgtaaaaaacgttgag
ttctctgttgatcttaaaattgaacctaggctcatatcaaaaaattccaagattaacatg
aagactagacagtataagctctttgcagttgtttatcatgatggtaaagaggcaaacaaa
ggtcattactttgctgatgtattctatgtggcgctcggtagatggttacggtttgatgac
gcatctgtacgttttgtcaccgacaaagaagtatgtcagccaaaacccccatgtatgccg
tatttgctgtactacagaagaaatgacacaattgctgcactctctgcgtttgataataaa
ggcagatag

DBGET integrated database retrieval system