KEGG   Acyrthosiphon pisum (pea aphid): 100160265Help
Entry
100160265         CDS       T01076                                 

Definition
asparagine synthetase [glutamine-hydrolyzing]-like
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100160265
Enzymes [BR:api01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     100160265
Peptidases [BR:api01002]
 Cysteine Peptidases
  Family C44
   100160265
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 556 aa AA seqDB search
MCGIWALFGVDVHSISKYDKTFSKIQHRGPDAWRLEYDLKVKNVCLGFHRLAIIDSLYGM
QPMKLHKFPFVSMICNGEIFNWKQLGEKHGFNYETQCDVESVLQLYGSFGIDETLKQLDA
EYAFCLIDSLKKKVFVARDPYGVRPLFYLASSNGILGISSEAKGLTCLVDELGLTEWEMK
PFPPGHMAEYYILPGGKLELISMNRFFKIEEPILTPVPLEEGLTEAIVHANIRNLLTQAV
EKRMMSNRRIGCLLSGGLDSSLIASILVKLSKEKGLPYPIQTFSVGMADSPDILAARQVA
KHIGSEHHEVLFTAEDVLSVLDKVIYTLETADITTIRASCGMYLVARYISQNTDTVVLCS
GEGADEVAQGYIYFRDAPTPDHAHNESLRLLGDIFMYDGLRADRTTAAHGLELRVPFLDL
RFTQYFLSLPKTMRQPQNQIEKHLLRSAFDGTGLLPNEVLWRHKEAFSDGVTTIKKSLFN
IIQEWIDPKYTDEDLKQAAIKYQHCPPNSKESLYYRDMFEKYYGGLSSKFMPYFWMPMWT
QVKDPSARFIQHYAAK
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatttgggcactttttggtgtcgacgtccattcaatttctaaatatgacaag
actttttcaaagattcaacacagaggcccagacgcatggagattggaatatgatttgaaa
gtgaaaaatgtctgtcttggatttcatcgtctcgcgattattgacagcctttacggaatg
caaccaatgaaattacacaaatttccatttgtttctatgatttgtaacggagaaattttc
aattggaaacagcttggagaaaaacacggtttcaattacgaaactcagtgtgatgtagag
agtgtgctacaactttatggaagtttcggtattgatgaaacattaaaacaattagatgca
gagtatgcgttctgtttgattgattctctaaagaaaaaagtattcgttgcaagagatcca
tacggtgtaaggccattattttacttagcatccagcaatggcattttgggaatatcttct
gaagcaaaaggtttgacatgtttggtcgatgaacttggccttaccgaatgggaaatgaag
cctttccctccaggtcacatggccgagtattatattttgcctggcggaaaactggagttg
atctcaatgaatcggttttttaaaatcgaggaacctattttgacgccagtacctttggaa
gaaggcttgactgaagcaattgtccatgctaatattcgtaatttactgacacaagctgtt
gaaaaaagaatgatgtcaaatcgtcgtattggttgcctattgtccggaggattggattct
agtttaatagcttccatattggttaagctgtccaaagaaaaaggtctcccgtacccgatt
cagacattttcggtcgggatggcggacagtccagatatattggcggcgagacaagtggcc
aaacatataggttcggaacaccacgaagtgctctttaccgccgaagatgtgctgagcgta
cttgacaaagtgatatacacgttggaaactgccgacatcacgacaatcagagcatcgtgt
gggatgtacttggtggcacggtacataagccaaaatacggacacggtggtcctgtgcagt
ggtgaaggtgccgacgaggtggcacaaggttatatttactttagggacgcgcccacgcca
gaccacgcgcacaacgagagtctcaggttgctgggtgatatattcatgtacgacggtttg
cgcgctgacaggacaacggccgcacacggactagaattgagagtacctttcttagatttg
cgttttactcagtatttcctgagcctccccaagacgatgagacaaccgcaaaaccaaatt
gaaaaacacctcctccgttcggcgtttgacggcacaggtctattgccgaacgaagtgttg
tggaggcacaaagaagcgttcagtgatggagttacaacaatcaaaaaatcattgttcaat
attatccaagaatggattgaccctaaatacacggatgaagatttaaaacaagcagcaata
aaataccaacattgtcctccgaattcaaaagagtcactgtactatagggatatgttcgaa
aaatactacggaggactatcttctaaattcatgccttacttttggatgccgatgtggaca
caagtaaaagatccatctgcaagatttattcaacattatgcagccaaataa

DBGET integrated database retrieval system