KEGG   Acyrthosiphon pisum (pea aphid): 100160284Help
Entry
100160284         CDS       T01076                                 

Definition
NADPH--cytochrome P450 reductase-like
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     100160284
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 681 aa AA seqDB search
MENPEGEKIESTVVSEEPLISALDIGLLVVIITVGYFWYIKRDKKSSSSEKKPYTIQPSS
LSSIEQTSNSSFIKKLKSTGRSLVVFYGSQTGTAEEFAGRIAKEGARYKMKGMVADPEEC
DMADLVEMKEIQKSLAIFCIATYGEGDPTDNAMDFYEWLQNGDADLEGLNYAVFGLGNKT
YEHYNEIAIYIDQRLEELGATRVHEIGLGDDDANIEDDFVSWKEKLWDSVCSHYGIEETG
EESNIRQYKLVDCSEVLPERIFSGEISRLKSYENQRFPFDVKNPYLSKISVNRELHKSGD
RSCMHIEFDIDGSKMRYDTGDHVAVYPKNSSELVEKIGELLNADLDTVFSLLNTDEESSK
KHPFPCPCTYRTALTYYLDITSNPRTHIMKELIEYASDPKDQEKLKLMASSTPEGKKEFH
EWILRDNRNIVHILEDLPSVKPDLDHLCELLPRLQCRYYSISSSPKVYPKSIHITAVLVE
YTTPTNRVNKGVATNLLAQLKPTNDELLQPTIPIYIRRSQFRLPPKSQTPIIMIGPGTGL
APFRGFIQERDYARKEGREIGEMVLYFGCRKKDEDFIYENELQEYVANGTLTKLHLAFSR
DQPEKQYVTHLLEQNADELWNIIGEKNGHLYVCGDARSMAKDVHSIIEKVVMEKGQMTNS
QALNYVKKMEQQKRYSADVWS
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggagaatcctgaaggagagaaaattgaatcaactgttgtttcagaagagccattgatt
agtgctttagatattggtcttttggtggttattataacagttggatatttttggtacatc
aaaagagataaaaagtcaagttcttcagaaaaaaaaccctatactattcagccatcttcg
ttgagttctattgagcagacctccaatagttcttttataaaaaaacttaaatcaaccggt
cgtagtttagtagtgttctatggaagtcaaacagggactgcagaagaatttgctggaaga
atagccaaagaaggggccagatataaaatgaaaggaatggtagccgatcctgaagaatgt
gatatggcagacttggtagaaatgaaagaaatacaaaagtcattggcaattttttgtata
gcaacatatggtgagggagacccgactgataatgctatggatttctacgaatggcttcaa
aatggtgacgccgacctagaaggattgaattatgcagtatttggattgggaaataagact
tacgagcattataacgaaattgctatttacattgatcaacgtttggaagaattgggtgct
actagagttcatgaaattggtctaggagatgatgatgccaatattgaagatgattttgtt
tcttggaaagaaaaattatgggatagtgtttgctcccattatggtattgaagaaactggc
gaagaaagtaatattagacaatacaaattagtagactgttccgaagttttaccagagcga
atattttcgggtgaaatatcacgacttaaatcttatgaaaaccaaagattcccatttgat
gttaagaacccatatttatctaaaatatcagttaatcgtgagctccacaagtcaggtgat
cgctcttgtatgcatattgagtttgatattgatggatcaaagatgaggtatgacacagga
gatcatgtggctgtctatcccaaaaattcttctgaattagtagagaaaattggagaattg
ttaaatgcagatctagacactgtattttcattgttgaacactgatgaggaatccagtaaa
aaacatccattcccttgtccttgtacttatcgaacagctttaacttattatttggatata
acttcaaatccacgcacacatattatgaaagaattaatagaatatgcaagtgatccaaag
gatcaagaaaaattaaagcttatggcaagctcaaccccagagggcaaaaaagaatttcac
gaatggatattgcgtgacaaccgtaatattgttcatattttggaagatttaccgagtgtc
aaaccagatttggaccatttatgtgaactactcccacgattgcagtgtcgttattattca
atatcctcgtcaccaaaagtgtacccaaaatctattcatattacagcagttctagtagaa
tacactactcctactaatcgagtcaataaaggtgttgcaactaacttattagcccaactg
aaaccaaccaatgacgaacttctacaacctactatacctatttatattagacgatctcaa
ttcagattgccccctaagagtcaaactccaattataatgattggtcccggtacaggatta
gcaccattccgaggttttatacaagaaagagattatgcacgtaaagaaggtagagaaata
ggagaaatggttctgtactttggatgtcgaaaaaaggatgaagacttcatttatgaaaat
gagttacaagaatatgttgctaatggaaccttaacaaagctacatttggcattttcgcgt
gatcaacctgaaaagcagtatgtgacacatttgttagaacaaaatgctgatgaactgtgg
aatattattggtgaaaaaaatggtcatttatatgtttgtggtgatgcaaggagcatggca
aaggatgtgcatagtattattgaaaaagttgtcatggaaaagggtcaaatgaccaatagt
caggcactcaattatgttaaaaaaatggaacaacagaaaagatattctgctgatgtgtgg
agctga

DBGET integrated database retrieval system