KEGG   Acyrthosiphon pisum (pea aphid): 100160324Help
Entry
100160324         CDS       T01076                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2C1-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00040  Pentose and glucuronate interconversions
api00053  Ascorbate and aldarate metabolism
api00830  Retinol metabolism
api00860  Porphyrin and chlorophyll metabolism
api00980  Metabolism of xenobiotics by cytochrome P450
api00982  Drug metabolism - cytochrome P450
api00983  Drug metabolism - other enzymes
api01100  Metabolic pathways
Module
api_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100160324
   00053 Ascorbate and aldarate metabolism
    100160324
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100160324
   00860 Porphyrin and chlorophyll metabolism
    100160324
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100160324
   00982 Drug metabolism - cytochrome P450
    100160324
   00983 Drug metabolism - other enzymes
    100160324
Enzymes [BR:api01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100160324
Glycosyltransferases [BR:api01003]
 Others
  Hydrophobic molecule
   100160324
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_4_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 100160324
NCBI-ProteinID: XP_001949466
APHIDBASE: ACYPI001628
UniProt: J9JN22
Position
Un
AA seq 522 aa AA seqDB search
MRWSPPSSRLSAVVVLVAALTCATDAARILAVETMAGISHWNFMSGVLRALVDNGHEVTT
FTPFPSADGHRPRDNYTEVDLSRELLAARDGQVLDVMQKWRTPVGNAFQWVRLSRDTCDK
IYGHPAMRDSLRPHRDGRPPFDVVIIEPFLSDCVSYVAVQLGVPLVFVTALPAVGLMERA
FTGHAANPAAESHLVAGHGVPKTFAQRLSNSALFAYSNVAVEYVDRVLKYTEPREYDTVP
PVMPSLVFVNGHYVSEPPNPVLPSVIHVGGIHLRPPKTLPKDILEFIEESSHGVIYFTFG
STVKMSSMPEHIKNAFINVLGQIPQRVLWKYEDELENKPKNVMMKKWLPQRDILMHPKVK
LFISHGGISGLYEAVDAGIPVLGFPLFGDQHRNIDNLVNAGMAISMDLFSVSEETFLKHV
LELINNKKYMINAKTTSNIFKDRPMTPAQSVVYWTEYVLRHKGAPHLKSHAVNLTWYQYY
LLDVISFAIILISVVFFAIYKIVKCVYKCTSICYSNVKAKIE
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgcggtggtcaccaccgtcgtccaggctgtcggcggtcgtcgtgctagtggcagcgttg
acgtgcgctacggacgccgcgaggatattggccgtggagacgatggccggcataagtcac
tggaacttcatgagcggcgtgctgcgggcgcttgtcgacaacggtcacgaggtcaccaca
tttacgccgtttccgtcggcggacggccaccgaccgcgggacaactacactgaggtggac
ctgtcccgggaactattggccgcccgggacggccaggtgctggacgtcatgcaaaagtgg
cgcacgcccgtcggcaacgcgttccagtgggtgcgactaagccgggacacgtgtgacaag
atctacggccacccggcgatgagggactcgctgcggccgcaccgggacggccgcccgcct
tttgacgtcgtcatcatcgaaccgttcttgtcggattgcgtgtcttacgtggccgttcag
ctgggcgtgccgcttgttttcgtcacggcgctgccggccgtcgggttgatggaacgcgcg
ttcaccggccacgcggccaaccccgcggccgagtcacacctggtggccggtcacggggtt
cccaagactttcgcgcagaggctgagcaactcggcgctgttcgcgtacagtaacgtcgct
gtagaatacgtggacagggtgctcaagtacaccgagcccagggagtacgatacggtacca
cccgtcatgccgtcgctggtgttcgtcaacggccattacgtcagcgaaccgcccaacccc
gtcctgccgtccgtcatccatgtcggcggcatccacctgagaccgcccaagacattgcca
aaggatatattagagtttattgaagaatcctcacatggtgtcatttatttcacttttggt
tcaactgttaaaatgtcttcaatgccagaacacatcaaaaatgcgtttattaatgtttta
ggtcaaattcctcagagagttttatggaaatatgaagatgaattagagaacaaaccgaaa
aacgtaatgatgaaaaagtggcttccccaacgagatatactaatgcaccctaaagttaaa
ctattcattagtcatggtggtatatccggattatatgaagctgtggatgccggtatccca
gtccttgggtttcctttatttggtgatcaacatagaaatatagacaatttagtcaatgct
gggatggcgatctcaatggacttattttctgtgtctgaagaaacattcttaaaacatgtt
ttagaacttatcaacaacaaaaagtacatgataaatgctaaaactacttccaatatattc
aaagatagaccgatgacaccagcacaatcggttgtttactggacagagtatgttcttcgt
cacaaaggtgcaccacatttaaaatctcatgcggttaatctaacgtggtatcaatattac
ttattggatgttatttcttttgcaataattttaatttctgtagttttttttgcaatttac
aaaattgtaaaatgcgtttataaatgtacttcaatatgttatagtaatgtgaaagcaaag
atcgaatag

DBGET integrated database retrieval system