KEGG   Acyrthosiphon pisum (pea aphid): 100160443Help
Entry
100160443         CDS       T01076                                 

Definition
STAM-binding protein
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:api00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100160443
Enzymes [BR:api01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100160443
Peptidases [BR:api01002]
 Metallo Peptidases
  Family M67
   100160443
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 410 aa AA seqDB search
MSHNKTSLDNFKEKPEKRIQQLLMLSSKIELNTSIPARKYYRSGREMISMADVYTKENNL
EQAYILYMRFMTLFLETINEHPDYKNVSIEERNLNYRALRDVLPKTENIKAKLLEKYSTE
YELFQEQKALGEFKEKHEQKVLNIEKNNTPSSKNVTQEHLNSILDNATVPELNNPTSFEL
RQPDHNLINFTELSDNNLPSNMPTYSNSKIQFNQHKPIVDRSTKPMLNKNTSNPYNLRQI
IVPGNLTRRFLEQAQRNTSNNLETCGILAGKLSSNCLIVTHLMIPKQSGTSDSCTTMNEE
DIFEYQDKQDLITLGWIHTHPSQTSFMSSVDLHTHYSYQLMMPEAIAIVCAPKYNESNFF
FLTPYHGLQVIADCKFFSGFHTHNTEGDIYAIAEHYVLDDNLLVNVVDFR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgagtcataataaaactagtttagacaattttaaagaaaaaccagaaaaaaggattcaa
caattgttgatgttaagttcaaaaatcgagttgaacacaagtataccagctagaaaatat
taccgatctgggcgagagatgatcagtatggctgatgtgtatactaaagaaaacaatttg
gaacaagcgtatattctttacatgagatttatgacattatttttggaaacaattaatgaa
catccagattacaaaaatgtatcaattgaagaacgtaatttaaattatcgggcacttcgc
gatgtccttccaaaaacagaaaatataaaagctaaattattagaaaaatatagtacagaa
tatgagttgtttcaagaacaaaaagcattaggagaatttaaagaaaaacatgaacaaaaa
gtattaaatatagaaaagaataatacaccatctagtaaaaatgtcactcaagaacattta
aactcaattttagataatgccaccgtacctgaattaaataatcctacatcatttgaatta
agacaaccagatcacaatttaatcaattttacagaattgagtgacaataatttaccttca
aatatgcctacatattcaaattcaaaaatacaattcaatcaacataagcctattgttgat
agaagtaccaaaccaatgttgaacaagaacacttcgaatccatataatcttcgccaaata
atagtcccgggtaatttaactagaagattccttgaacaagcacaacgtaatacatccaat
aacttggagacttgtggtatattagcaggaaaattgagttctaactgtttaatcgtgacc
catttgatgattccaaaacaaagtggtacatcagattcatgtactacaatgaatgaagaa
gatatctttgaatatcaagataaacaagatctcatcaccttaggatggatacatactcat
ccatcacaaacctcatttatgtcaagtgtagacttacatacgcattattcatatcaatta
atgatgccagaagctattgcaattgtttgtgcacctaaatataatgaatcaaatttcttc
tttttgacgccttatcatggcttacaagttatagctgattgcaaatttttcagtggtttc
cacacacataacacagagggtgatatttatgccattgctgaacattatgtattggatgac
aacctgctggtcaatgtagttgattttagatag

DBGET integrated database retrieval system