KEGG   Acyrthosiphon pisum (pea aphid): 100160443Help
Entry
100160443         CDS       T01076                                 

Definition
STAM-binding protein-like
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:api04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 410 aa AA seqDB search
MSHNKTSLDNFKEKPEKRIQQLLMLSSKIELNTSIPARKYYRSGREMISMADVYTKENNL
EQAYILYMRFMTLFLETINEHPDYKNVSIEERNLNYRALRDVLPKTENIKAKLLEKYSTE
YELFQEQKALGEFKEKHEQKVLNIEKNNTPSSKNVTQEHLNSILDNATVPELNNPTSFEL
RQPDHNLINFTELSDNNLPSNMPTYSNSKIQFNQHKPIVDRSTKPMLNKNTSNPYNLRQI
IVPGNLTRRFLEQAQRNTSNNLETCGILAGKLSSNCLIVTHLMIPKQSGTSDSCTTMNEE
DIFEYQDKQDLITLGWIHTHPSQTSFMSSVDLHTHYSYQLMMPEAIAIVCAPKYNESNFF
FLTPYHGLQVIADCKFFSGFHTHNTEGDIYAIAEHYVLDDNLLVNVVDFR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgagtcataataaaactagtttagacaattttaaagaaaaaccagaaaaaaggattcaa
caattgttgatgttaagttcaaaaatcgagttgaacacaagtataccagctagaaaatat
taccgatctgggcgagagatgatcagtatggctgatgtgtatactaaagaaaacaatttg
gaacaagcgtatattctttacatgagatttatgacattatttttggaaacaattaatgaa
catccagattacaaaaatgtatcaattgaagaacgtaatttaaattatcgggcacttcgc
gatgtccttccaaaaacagaaaatataaaagctaaattattagaaaaatatagtacagaa
tatgagttgtttcaagaacaaaaagcattaggagaatttaaagaaaaacatgaacaaaaa
gtattaaatatagaaaagaataatacaccatctagtaaaaatgtcactcaagaacattta
aactcaattttagataatgccaccgtacctgaattaaataatcctacatcatttgaatta
agacaaccagatcacaatttaatcaattttacagaattgagtgacaataatttaccttca
aatatgcctacatattcaaattcaaaaatacaattcaatcaacataagcctattgttgat
agaagtaccaaaccaatgttgaacaagaacacttcgaatccatataatcttcgccaaata
atagtcccgggtaatttaactagaagattccttgaacaagcacaacgtaatacatccaat
aacttggagacttgtggtatattagcaggaaaattgagttctaactgtttaatcgtgacc
catttgatgattccaaaacaaagtggtacatcagattcatgtactacaatgaatgaagaa
gatatctttgaatatcaagataaacaagatctcatcaccttaggatggatacatactcat
ccatcacaaacctcatttatgtcaagtgtagacttacatacgcattattcatatcaatta
atgatgccagaagctattgcaattgtttgtgcacctaaatataatgaatcaaatttcttc
tttttgacgccttatcatggcttacaagttatagctgattgcaaatttttcagtggtttc
cacacacataacacagagggtgatatttatgccattgctgaacattatgtattggatgac
aacctgctggtcaatgtagttgattttagatag

DBGET integrated database retrieval system