KEGG   Acyrthosiphon pisum (pea aphid): 100160481Help
Entry
100160481         CDS       T01076                                 

Definition
laminin subunit gamma-1-like
Orthology
K05635  
laminin, gamma 1
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:api00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100160481
Cell adhesion molecules and their ligands [BR:api04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     Laminin-1 Extracellular matrix (ECM) components
      100160481
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
      100160481
     Laminin-2 Extracellular matrix (ECM) components
      100160481
   VLA-2
     Laminin-1 Extracellular matrix (ECM) components
      100160481
   VLA-3
      100160481
     Laminin-10 Extracellular matrix (ECM) components
      100160481
     Laminin-11 Extracellular matrix (ECM) components
      100160481
   VLA-6
     Laminin-1 Extracellular matrix (ECM) components
      100160481
     Laminin-8 Extracellular matrix (ECM) components
      100160481
   VLA-7
     Laminin-1 Extracellular matrix (ECM) components
      100160481
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     Laminin-1 Extracellular matrix (ECM) components
      100160481
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1631 aa AA seqDB search
MKLIPMSPLSLLLTAVVAAAVVAAVPDVTIPVEPIYNTGGNQCYDERNKPQRCIPGFENA
AFGLEVEATNTCGQSGPTEFCVQSGSQVTKKTCDVCTESSHSPYYMTDFSSYANRTWWQS
ETMYESVQYPNQVNLTLHFGKAFDITYIRLLFYSPRPESFAMYKKSTEDGPWIPYQFYSG
SCRDTYGLPDLNYIRLGEQETRAFCTSEFSDISPLTGGSVPFSTLEGRPSAKFYDTKSEF
WDWVTATDVRITLDRLNTFGDEVFGDPQVLKSYFYAIADFAVGARCKCNGHASECVKSTS
INGTSRRVCRCEHNTAGPDCNECLPFFNDAPWSRATATNAHECKECNCNEFSHRCFFDKE
LYDRTGHGGHCLDCAGNRDGANCERCRENYYQRKGDTHCSPCECNDVGSRSLQCNSEGKC
QCRAGVAGDKCDRCAENHFDFGPTGCKPCGCIVAGSLDNEPRCEAENGNCICKENVEGIQ
CNKCKPGFFNLDEDNLFGCTPCFCYGHSSVCQSASGYSRVSIESVFVRGNERWNGSDVFG
RTVLPVHSPFKQSLEISSPSKDAVYLLAPDKFLGDQRSSYNHDLTFKLSIGENSPDPTIN
DIILEGGAGLRVTQAIFGQGNTLPSDTPKMYKFRLHENPDYGWQPRLSARDFFSVLSNLT
AIKIRGTYSDRGVGFLDDVSLQTARRGAPGLPANWVEMCTCPEGYIGQFCESCAPGSRHE
PTSGGPFSPCVPCNCHGHASICDADTGRCICQHNTAGENCDRCAKGYYGNAMQGTALDCK
LCPCPNQGSCVLIGEDTVICLECPKGYGGPRCDICSDGYFGDPTGKTGPISICKSCDCNS
NVDPNGIGNCNRTTGDCLKCIYNTGGPQCDQCLPGYFGDALAPEKGDCKPCDCFHLGTTE
TGFGPLACDQLTGQCQCKPHVTGVNCDQCEVGHFNIASGEGCQSCDCDPVGSVNNTCDTN
TGQCICRPGITGKKCDACEPYHYGFSIEGCKSCACDTIGAVSLQCDANGQCPCLENVEGR
RCDQCKENKYDRQRGCVDCPACYNLVQDAVAAHRENLRKLEDVLKNINNNPTVVIDDDFE
QKLKEVQSQVDELEQNAKFATGGNIPTSDKLESLQSQIKEIQDLMAQTGSWTATAEEKSI
EAENNIMNIEKINDKAANTLKRALEYIETEGATSLLKAVTKSNELGQQSDQMSEIAREAR
TFLASKEEEMEKMRVTAEKARHVSLEAYNITRDAVNQQKNISDELKSLDTEVNYVKDKLN
TIITSANEAQELVTMVNNDSLTIYRDIYAINLPDVNVAALKENISNLNAESEQIKNDLKI
QETDLNISKLIKDVADELQQSEITLAQGEQQQRTRENYLAQANASYEKADQAVKLGVKIL
EEAQQTLSTLQAFDKQVQDSKKNATEALGQVSQIRQLIEEANDKTIRAQQALAGAELSAI
HARDTAKEAQQTYADQASEDSNKIKKAGENLASEVHKLFDESMGQIKRVGHTAERLKDAE
IQFEQDQKSIDDAKTKIGQAKTSASESKKMVDKALQDVENISKELLDLADSDTDKLSLLS
SRLESAEQELMNAELDKKLAAINSAKISQAQLINKLKEDIKTLTNDVKNIEAIRLALPVG
CWKKTNIEELR
NT seq 4896 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgatcccgatgtcgccgctgtcgctgctgctgaccgcggtcgtggccgccgcc
gtggtcgccgccgtgcccgacgtcaccatccccgtcgaaccgatctacaacacgggcggc
aatcaatgttacgacgaacgcaacaaacctcagagatgtataccgggtttcgagaacgcg
gcgttcggattagaagtcgaagcaaccaacacgtgtggccaatccggccctacagaattt
tgtgtgcagtcgggcagtcaagttaccaagaagacgtgtgacgtgtgcaccgaatcatct
cactcgccctactacatgacagatttcagcagctacgcgaatcgaacgtggtggcagtcg
gaaaccatgtacgagagcgttcaatacccgaaccaagtcaacctgaccctgcacttcggt
aaagcattcgatatcacgtacatccgacttctgttttactcgcctaggcccgaaagtttc
gcgatgtataagaaaagtacagaagatggaccgtggataccgtatcagttctacagtggg
agttgtagagacacctacggattgccagacttgaattacatccgtcttggcgaacaagag
accagggcgttctgtacttccgagttttcagatatttcgccattgacgggaggaagtgtg
ccattttccacactagaaggtagaccatcggctaaattttacgatacaaaatcggaattt
tgggactgggtaaccgcgacagatgtccgtatcacgttagatcgtttaaatacatttggt
gacgaagtatttggagatcctcaagtactgaagtcatatttctatgctattgctgatttc
gctgttggagccagatgcaagtgtaacggccacgccagtgaatgtgttaaaagcacttca
atcaatggcacttccaggagagtgtgtcggtgcgagcacaatacggctgggcccgactgc
aatgagtgtctgccgttcttcaacgacgcgccttggagcagagcgaccgcaacaaacgca
cacgagtgtaaagaatgcaattgcaacgagttttctcaccggtgcttcttcgacaaagag
ctatacgaccggaccggacacggaggacactgtctagactgcgccgggaaccgggacggg
gcgaactgcgagcggtgcagggagaactactaccagaggaagggcgacacgcactgttcg
ccgtgcgagtgcaacgacgtcgggtcgcggagcttgcagtgtaactccgaaggcaagtgc
caatgtcgtgcgggcgtggccggcgacaaatgcgaccggtgcgccgagaaccatttcgat
ttcgggccgaccggatgcaaaccgtgcggatgtatcgtggccggtagtctggacaacgag
ccgaggtgcgaggccgaaaacggaaattgcatttgcaaggagaacgtcgagggcattcaa
tgcaacaaatgtaaaccgggtttcttcaacttggacgaggacaatttattcggttgtact
ccttgtttctgctatggacattcttcggtgtgccagtccgcttcgggttattcaagagtt
tccatcgagagcgtgttcgtccggggcaacgagcgatggaatggttcggacgtcttcggc
agaacggtgttgccggtccacagtccgttcaaacagtcgttggagatttcctcgccgtcg
aaggacgccgtctacttattggcaccggacaagttcctcggggaccagcgttccagttac
aatcacgacttgaccttcaaactgagcatcggcgaaaacagtcccgacccgaccatcaac
gacatcatcctggagggcggtgctggtcttcgcgtcacccaagcgatattcggacaagga
aacacattgccttccgacacgccaaaaatgtacaaattccgcctacacgagaacccggac
tatggctggcagcccaggctgtctgctcgggatttcttcagcgtattatcgaatctgacg
gccatcaaaataagaggaacatattccgatagaggtgtcggattcctggacgacgtttcg
cttcagacggcccggcgcggtgctcccggattgccggccaactgggtggagatgtgcact
tgtcccgaaggatacatcggacaattctgcgagtcgtgcgcacctggttctcgacacgag
cctaccagcggtggtcctttctcgccgtgcgtcccgtgtaactgtcacggtcatgcctcc
atctgcgacgcggacacaggtcggtgcatttgtcagcacaacactgctggcgagaattgc
gacaggtgtgcgaaaggatactacggtaacgctatgcagggcaccgcgctcgactgtaag
ctgtgtccatgccccaaccagggaagttgcgttttgatcggagaggacacggtcatttgt
ctggaatgtcccaagggatacggaggcccaagatgcgacatctgcagtgacggatacttt
ggagacccgaccgggaagaccggaccgatcagcatttgcaaatcgtgcgactgcaattcg
aatgtcgatccgaacggaattggtaactgcaatcggacgaccggcgattgtttgaagtgc
atctacaatacgggtggaccgcagtgcgaccaatgtctacctggatacttcggggacgct
cttgctcccgaaaaaggcgattgcaaaccttgtgattgtttccatcttggcaccaccgag
acgggattcggacctttggcatgcgaccagttgaccggtcagtgccagtgtaaaccacac
gtgactggagtaaactgcgaccagtgcgaagttggtcacttcaatatagccagcggagaa
ggttgtcagtcgtgtgattgcgatccggtgggttccgtcaacaacacttgtgacaccaac
accggtcagtgtatttgtcgtccgggcataaccggcaaaaaatgtgatgcgtgcgaacca
taccactacggattttcaatcgaggggtgtaaatcgtgtgcttgcgataccatcggtgcc
gtgtctttgcagtgcgatgcgaacggacagtgtccgtgtttagaaaatgtggaaggaaga
cgttgcgatcagtgtaaagaaaacaaatatgaccggcaaagaggttgtgtggactgtcca
gcctgttataacttggttcaagatgccgttgcagcacaccgtgaaaacttaagaaaactt
gaagacgtgttaaaaaatattaataacaacccaactgtagtaatcgacgacgatttcgaa
caaaaactgaaggaagttcagtcgcaagtcgatgagctggaacagaatgccaaattcgct
accggtggtaacattccaacgagtgacaaattagagtcacttcagagccaaataaaggaa
attcaagatctaatggctcaaacagggagctggactgctacagctgaagaaaaatctata
gaggctgaaaacaacatcatgaatattgaaaaaataaacgacaaagcggcaaatacgttg
aaaagagcgttggagtacattgaaaccgaaggagccacgtcgcttctcaaggctgtaaca
aaaagtaacgaactcggacaacagagcgaccaaatgtctgagattgccagggaagctcgg
acgtttttagcgtcaaaagaggaagaaatggaaaaaatgagagttactgcagaaaaagca
aggcatgtatcacttgaagcatataacattaccagagacgctgtaaatcaacagaaaaat
atcagtgatgaattgaaatctttggatacggaggtcaactatgtaaaggataaattgaat
acaatcattacctcagcaaacgaagcacaagaattggtgactatggtcaataatgactca
ttgacaatatatcgagatatttacgctataaacttaccagatgtcaatgtagcagctttg
aaagaaaatatttccaatttaaacgcagagtccgaacaaatcaagaatgatttaaaaata
caagaaactgacctaaacattagtaagctcattaaagacgtagccgatgagctacaacaa
tctgagattacattagctcaaggcgagcagcagcaacgaaccagggaaaactatttggca
caagcaaatgcttcttatgaaaaagccgaccaagcggttaaattaggtgtaaagattttg
gaagaagctcaacaaacactgagcacattgcaagcattcgacaagcaggtgcaagatagt
aaaaaaaatgcaacggaggccttagggcaggtttcacaaattagacagttgatagaagag
gccaacgataagactatacgtgcccaacaagcattagctggagccgaactgagtgccata
catgccagggacaccgccaaagaggcacaacaaacatacgctgatcaagcatcagaggat
tcgaataaaataaagaaagctggggaaaatttggcgtccgaagttcacaagttattcgac
gaaagtatgggccagataaaacgagtcgggcacaccgccgaacgcttgaaagacgcggaa
atccaattcgaacaggaccaaaaaagcattgacgatgcaaaaacgaaaatcggccaagcg
aaaacatcggcatctgaatctaaaaaaatggttgacaaagcactgcaggatgtcgaaaac
atatcaaaagaattattagatctggccgacagtgatactgacaagctgagtctactcagc
agcagattggaatcggccgaacaggagctgatgaacgccgagttggacaagaaacttgcg
gctatcaatagtgctaagatttctcaagctcagttaattaacaaactaaaagaagatatc
aaaacattgacaaatgatgtaaaaaatatcgaagcaatacggctagcacttccggtcgga
tgctggaagaaaacgaatatagaagaattgcgttga

DBGET integrated database retrieval system