KEGG   Acyrthosiphon pisum (pea aphid): 100160533Help
Entry
100160533         CDS       T01076                                 

Gene name
Eif3j
Definition
eukaryotic translation initiation factor 3, subunit J
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:api00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100160533 (Eif3j)
Translation factors [BR:api03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100160533 (Eif3j)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 241 aa AA seqDB search
MEWDADNFEPAKPIIPVADIVGGAKLNKWEGEDEEENIKDSWDAEEEETKKTETKVPEKK
TKSKLEQKIAERERKQKIENEKMRRKFLEAEENSNMTPEEKKLLQQKLQEEADLEVAKEM
LGVDESDEDSIDRMNPKSKEDFIVFEQALQKKIQSFSKSDHYSDFIEELIRNLSVTLSMN
DLRKLKASVDNMSTEKMKAEKGDKNKKNKGKGKAKLRLDNSTIPDYNEFSAYTVDDYEEF
M
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggagtgggatgctgataattttgaacccgctaagcccatcattcccgttgctgatatt
gttggcggtgctaagctcaacaaatgggaaggcgaagatgaagaagagaatattaaggat
agctgggatgcagaagaagaagaaacaaaaaaaactgagacgaaagtccccgagaaaaaa
accaaatcaaaattggaacaaaaaatagctgaaagagaacgaaaacaaaaaatagaaaat
gaaaaaatgaggcgaaaatttttggaggcagaagaaaattcaaacatgacacccgaagaa
aagaagctattacaacagaaactacaagaagaagcagatttggaagtagcgaaagaaatg
ttaggtgtagatgaaagtgatgaagattcaatagaccgtatgaatccaaaatcaaaagaa
gatttcattgtttttgaacaagctcttcaaaaaaaaatacaaagtttttctaaatctgat
cattattctgattttattgaagaacttataaggaatttatctgttacattgtcgatgaat
gatttgagaaagttaaaagcaagtgtagataatatgagtacagaaaaaatgaaagcagaa
aagggtgataaaaataaaaaaaataaaggcaaaggaaaagctaaactgcgactcgacaac
agtactattcctgattacaatgagttttcagcttatacggtggatgattatgaagagttc
atgtag

DBGET integrated database retrieval system