KEGG   Acyrthosiphon pisum (pea aphid): 100160676Help
Entry
100160676         CDS       T01076                                 

Definition
eukaryotic translation initiation factor 4E-like
Orthology
K03259  
translation initiation factor 4E
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:api03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:api04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 214 aa AA seqDB search
MVEGEPVNQSDELPKVENEQPIETEPAIAELVVKHPLENKWTLWFFENKSKVWEENIHEV
ASFDTVEDFWCLFNHIKRPSQLSYQCDYNYFKNGIKPMWEDGKNSAGGRWLLQLPPAKNS
QLVDEYWKNIILSIIGEIYDQSSEINGAIVNVRSKGTKIAVWTNNASKDNGSNIMAIGRK
IKEVLGAQNEKMVYESHADTANKQGSFTKHAFMI
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggttgagggagaaccagttaatcagtcagatgaattaccgaaagttgaaaatgaacaa
cccattgaaactgaaccggctattgcagaattagttgttaaacatccattagagaataaa
tggacactttggttctttgaaaataaaagtaaagtttgggaagaaaatatacatgaagtt
gctagttttgatactgttgaagatttttggtgcttattcaatcacatcaaacgtccaagt
caactttcgtaccaatgtgattacaattattttaaaaatggaatcaaacctatgtgggaa
gatggaaaaaatagtgccggtggtcgttggttattacagttaccaccagcaaaaaatagc
caacttgttgatgagtactggaaaaatataatattaagtataattggtgaaatatatgac
caaagctctgaaattaatggagctatagttaacgtacgaagcaaaggaactaagatagca
gtatggacaaacaatgcatcaaaagataatggcagtaatattatggctattggaagaaaa
ataaaagaagttttgggcgcacaaaatgaaaagatggtttatgagtctcacgcagataca
gcaaataaacaaggatcatttacaaaacacgcgtttatgatataa

DBGET integrated database retrieval system