KEGG   Acyrthosiphon pisum (pea aphid): 100160720Help
Entry
100160720         CDS       T01076                                 

Definition
UDP-glucose pyrophosphorylase 2-like
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100160720
   00052 Galactose metabolism
    100160720
   00500 Starch and sucrose metabolism
    100160720
   00520 Amino sugar and nucleotide sugar metabolism
    100160720
Enzymes [BR:api01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     100160720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 516 aa AA seqDB search
MSTNLLSVNTDEHQPKGHSRVPSSTDLKEFKEVTQRDSLVQLEKEMTALLTTTADDKKDL
AKSQFTAFSRLFQRFLEESGPSVDWDKIEKLPTDAIRDYDTLSKPSPDDIHSKLEKLVVV
KLNGGLGTSMGCRGPKSVIQVRNDLTFLDLTVQQIEHLNKKYNVNVPLVLMNSFNTDKDT
EQIIRKYKGLQVEIYTFNQSCFPRVSKESLLPIAHDCDIEGNIEAWYPPGHGDFYDSFKN
SGLLQKFIDSGRDYCFISNIDNLGATVDLNILNMLLDRGTNPLEFVMEVTNKTKADVKGG
TLIQYENKLRLLEIAQVPKEHLEEFKSVKKFKFFNTNNLWIKLDAIEKVLNEGSMNLEII
VNNKTLDNNLNIIQLETAVGAAMKSFNGGLGINVPRSRFLPVKKTSDLLLVMSNLYHMRN
GSLSMSPLRMFPTTPLVKLGDKDFAKVKDFLSRFATIPDILELDHLTVSGDVTFGRNVSL
KGTVIIIANHGDRIDIPSNATLENKIVSGNLRILDH
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtctactaacttattatctgtcaacacagatgaacatcagccaaaaggacactctcgt
gtaccttcaagtacagacttgaaagagttcaaagaagttacccaacgcgattcattggta
caactagaaaaagaaatgaccgctttgcttacaactacagcagatgataaaaaagatttg
gcaaaatctcaatttacggcgttttcacgtttatttcaacgattcctggaagaatctggc
ccatcagttgattgggacaagattgaaaaattgcctactgatgctatacgagattatgat
actttatcgaaaccaagtcctgatgatattcattcaaagcttgaaaaattggtggtggtt
aagcttaatggaggtcttggtacatccatggggtgtcgaggtccaaaatctgttatacaa
gtcagaaatgatcttaccttccttgatttaacggttcaacaaattgagcacttaaataaa
aaatacaatgtaaatgtaccattggttttgatgaactcttttaatacggataaagataca
gaacaaatcattcgaaaatataaaggacttcaagtagagatatatacatttaaccaaagc
tgttttcctcgagtatctaaagaatcacttttaccaattgcacatgactgtgatattgaa
ggcaacattgaagcatggtatcctccaggtcacggagatttttatgatagttttaaaaat
tcaggattactgcaaaagtttattgatagcggtcgtgattattgtttcatctcaaacatt
gacaacttaggtgcaactgttgacctaaatattctcaatatgttattggaccgtggaact
aatccccttgaatttgtaatggaagttaccaataaaactaaagctgatgtaaaaggtggt
actttaattcagtatgagaataaattgagactattggaaatagctcaagttcctaaagaa
catcttgaagaatttaaatcagtaaaaaaatttaagtttttcaataccaacaacctatgg
atcaaacttgatgctattgagaaagttctaaacgaaggatcgatgaatttggaaattata
gtcaataacaaaacattagacaataatttaaatatcattcaacttgaaacagcagttggt
gcagctatgaaatcttttaatggtggtcttggtataaatgtacccagaagtcgtttctta
ccagttaaaaaaacttctgatcttttattggtaatgagcaacttgtaccacatgagaaat
ggatcattgtcaatgagtccattgagaatgtttcctacaactccgttagttaaacttgga
gataaagattttgccaaagtaaaagattttttgtctcgttttgcaactattcctgatata
cttgaattggatcatttaacagtttctggtgacgtaacatttggtcgaaatgtttctttg
aaaggaactgttattataatcgcaaatcatggagacagaatcgatatcccttcaaatgca
acacttgagaacaagatagtgtctggaaatctgagaatactcgaccattaa

DBGET integrated database retrieval system