KEGG   Acyrthosiphon pisum (pea aphid): 100160720Help
Entry
100160720         CDS       T01076                                 

Definition
UDP-glucose pyrophosphorylase 2-like
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:api00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:api00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:api00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:api00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 516 aa AA seqDB search
MSTNLLSVNTDEHQPKGHSRVPSSTDLKEFKEVTQRDSLVQLEKEMTALLTTTADDKKDL
AKSQFTAFSRLFQRFLEESGPSVDWDKIEKLPTDAIRDYDTLSKPSPDDIHSKLEKLVVV
KLNGGLGTSMGCRGPKSVIQVRNDLTFLDLTVQQIEHLNKKYNVNVPLVLMNSFNTDKDT
EQIIRKYKGLQVEIYTFNQSCFPRVSKESLLPIAHDCDIEGNIEAWYPPGHGDFYDSFKN
SGLLQKFIDSGRDYCFISNIDNLGATVDLNILNMLLDRGTNPLEFVMEVTNKTKADVKGG
TLIQYENKLRLLEIAQVPKEHLEEFKSVKKFKFFNTNNLWIKLDAIEKVLNEGSMNLEII
VNNKTLDNNLNIIQLETAVGAAMKSFNGGLGINVPRSRFLPVKKTSDLLLVMSNLYHMRN
GSLSMSPLRMFPTTPLVKLGDKDFAKVKDFLSRFATIPDILELDHLTVSGDVTFGRNVSL
KGTVIIIANHGDRIDIPSNATLENKIVSGNLRILDH
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtctactaacttattatctgtcaacacagatgaacatcagccaaaaggacactctcgt
gtaccttcaagtacagacttgaaagagttcaaagaagttacccaacgcgattcattggta
caactagaaaaagaaatgaccgctttgcttacaactacagcagatgataaaaaagatttg
gcaaaatctcaatttacggcgttttcacgtttatttcaacgattcctggaagaatctggc
ccatcagttgattgggacaagattgaaaaattgcctactgatgctatacgagattatgat
actttatcgaaaccaagtcctgatgatattcattcaaagcttgaaaaattggtggtggtt
aagcttaatggaggtcttggtacatccatggggtgtcgaggtccaaaatctgttatacaa
gtcagaaatgatcttaccttccttgatttaacggttcaacaaattgagcacttaaataaa
aaatacaatgtaaatgtaccattggttttgatgaactcttttaatacggataaagataca
gaacaaatcattcgaaaatataaaggacttcaagtagagatatatacatttaaccaaagc
tgttttcctcgagtatctaaagaatcacttttaccaattgcacatgactgtgatattgaa
ggcaacattgaagcatggtatcctccaggtcacggagatttttatgatagttttaaaaat
tcaggattactgcaaaagtttattgatagcggtcgtgattattgtttcatctcaaacatt
gacaacttaggtgcaactgttgacctaaatattctcaatatgttattggaccgtggaact
aatccccttgaatttgtaatggaagttaccaataaaactaaagctgatgtaaaaggtggt
actttaattcagtatgagaataaattgagactattggaaatagctcaagttcctaaagaa
catcttgaagaatttaaatcagtaaaaaaatttaagtttttcaataccaacaacctatgg
atcaaacttgatgctattgagaaagttctaaacgaaggatcgatgaatttggaaattata
gtcaataacaaaacattagacaataatttaaatatcattcaacttgaaacagcagttggt
gcagctatgaaatcttttaatggtggtcttggtataaatgtacccagaagtcgtttctta
ccagttaaaaaaacttctgatcttttattggtaatgagcaacttgtaccacatgagaaat
ggatcattgtcaatgagtccattgagaatgtttcctacaactccgttagttaaacttgga
gataaagattttgccaaagtaaaagattttttgtctcgttttgcaactattcctgatata
cttgaattggatcatttaacagtttctggtgacgtaacatttggtcgaaatgtttctttg
aaaggaactgttattataatcgcaaatcatggagacagaatcgatatcccttcaaatgca
acacttgagaacaagatagtgtctggaaatctgagaatactcgaccattaa

DBGET integrated database retrieval system