KEGG   Acyrthosiphon pisum (pea aphid): 100160833Help
Entry
100160833         CDS       T01076                                 

Definition
probable histone acetyltransferase MYST1-like
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100160833
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 463 aa AA seqDB search
MVVHHSATSVSMEVDPPRNANSPDDPKTANGSSENEKAEDSESSEDGPLDVGEHYLVRRY
DDSWHPAEVLHTRFNDTEHLFEYYVHYEGYNRRLDQWVPRDRIMNSRFDISEKNWKQKDV
NKNLDLLNQSDRKITRNQKRRHDEINHVPMSYAEMDPTTAALEKEHEAITKIKYINKVQL
GKYEIDTWYFSPFPAEYQKESKIWICEYCLKYSKLEKSFKYHMSQCTWRQPPGVEVYHKG
SLSIWEVNSSQHKMYCQNLCLLAKLFLDHKTLYFDVEPFLFYILCEVDKVGAHLVGYFSK
EKDSPDCNNVACILTMPPFQRQGYGKLLIAFSYELSKLEGLVASPEKPLSDLGKLSYRSY
WSWVLLEILKNACGSLSIKDLSAMTSITQTDIISTLQSMNMVKYWKGQHVICVTPKNVEQ
LVSSEQYKRPRFILEGSAIKWTPKKYNPRPGPSRHSRSQYLAG
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtgcatcacagcgcgacgtccgtcagcatggaggtggatccaccgcggaacgcc
aacagcccggacgacccgaaaaccgctaacggctcatcggaaaacgagaaggccgaggat
tcggaatcatcggaagacgggccgctagacgtgggcgaacattacctggttcgccggtac
gacgactcgtggcatcccgcagaagtcttacatacgaggttcaatgatacagaacatctt
tttgagtattatgtacactatgaagggtacaaccgaagattggatcaatgggtaccaaga
gataggataatgaattcaagatttgatatttctgaaaaaaattggaaacaaaaggatgta
aataaaaatttagatcttctaaatcagtccgacagaaagatcacaaggaaccaaaaacga
agacacgacgagataaatcatgttccaatgtcttacgcagaaatggatccaactactgct
gcattggaaaaagagcacgaggcgataactaaaattaaatacatcaataaagtacagttg
ggaaagtatgaaattgacacatggtattttagtccatttccagcagaataccaaaaagaa
tctaaaatttggatttgtgaatactgtttaaaatacagcaaactagaaaaatcattcaaa
taccatatgagccaatgcacatggagacaaccacctggtgttgaagtgtaccataaagga
tcattatcaatctgggaagtgaattccagtcaacacaaaatgtactgtcagaatctttgt
ctattggctaagttatttttagaccataaaacactttactttgatgttgaaccatttttg
ttttacatcctttgtgaagttgacaaagttggtgcacatttagttggatatttttcaaaa
gaaaaagattcaccagattgcaacaatgtagcttgtatattaacaatgccaccattccag
agacaaggttatggtaaactattaatagcattcagctatgaattgagcaagttggaagga
cttgtagccagtcctgaaaagcctttaagtgatcttggtaaattgtcatacagatcttat
tggtcatgggtactgttggaaattctgaaaaatgcttgtggatctttatcaattaaagac
ttaagcgcgatgactagtattacccaaacggatatcatttcaacgttgcagtccatgaac
atggtgaagtactggaaaggccaacatgtgatttgtgtgacgcctaaaaacgttgaacag
ctggttagttcagaacagtataaacgaccaagattcatattagaaggaagtgctatcaaa
tggacgccaaaaaagtacaatcctcgcccaggaccatctaggcattcaagatcacaatac
ttagctggataa

DBGET integrated database retrieval system