KEGG   Acyrthosiphon pisum (pea aphid): 100160884Help
Entry
100160884         CDS       T01076                                 

Definition
profilin-like
Orthology
K05759  
profilin
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Exosome [BR:api04147]
 Exosomal proteins
  Proteins found in most exosomes
   100160884
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 127 aa AA seqDB search
MSSWQDYVDKHLIASRCVTKAAISGHDGTVWATSDGFNVTKEELSRLIAGFENQNVLAAS
GVTLAGSRYIYLSGTDKVIRAKLGKVGAHCVKTQQAVVVSLYEDPIQPQQAASVVEKLGD
HLVAHGY
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcttggcaagattatgttgacaaacatcttatagcatctcgatgcgttaccaaa
gccgctatctcaggtcatgacggcactgtatgggccacttcagatggatttaatgttacc
aaggaagaactcagcagactaattgctggttttgaaaaccaaaatgttttggctgcttca
ggtgtaacgttagctggcagtaggtacatttatttgtctggtactgataaagtcattaga
gcaaagctgggtaaagtaggtgcacactgtgtgaagacccaacaagccgttgttgtttca
ttatatgaagaccccattcaaccacaacaagctgcctctgttgttgaaaagcttggcgat
catttggttgcccatggatactga

DBGET integrated database retrieval system