KEGG   Acyrthosiphon pisum (pea aphid): 100160884Help
Entry
100160884         CDS       T01076                                 

Definition
(RefSeq) profilin-like
  KO
K05759  
profilin
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:api00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    100160884
Cytoskeleton proteins [BR:api04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     100160884
Exosome [BR:api04147]
 Exosomal proteins
  Proteins found in most exosomes
   100160884
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
APHIDBASE: 
UniProt: 
Position
Un
AA seq 127 aa AA seqDB search
MSSWQDYVDKHLIASRCVTKAAISGHDGTVWATSDGFNVTKEELSRLIAGFENQNVLAAS
GVTLAGSRYIYLSGTDKVIRAKLGKVGAHCVKTQQAVVVSLYEDPIQPQQAASVVEKLGD
HLVAHGY
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcttggcaagattatgttgacaaacatcttatagcatctcgatgcgttaccaaa
gccgctatctcaggtcatgacggcactgtatgggccacttcagatggatttaatgttacc
aaggaagaactcagcagactaattgctggttttgaaaaccaaaatgttttggctgcttca
ggtgtaacgttagctggcagtaggtacatttatttgtctggtactgataaagtcattaga
gcaaagctgggtaaagtaggtgcacactgtgtgaagacccaacaagccgttgttgtttca
ttatatgaagaccccattcaaccacaacaagctgcctctgttgttgaaaagcttggcgat
catttggttgcccatggatactga

DBGET integrated database retrieval system